CAZyme Information: MGYG000002240_00612

Basic Information

• Species: UBA11963 sp900552975
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA11963; UBA11963 sp900552975
• CAZyme ID: MGYG000002240_00612
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		43392.46	8.5888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002240	1580436	MAG	Peru	South America

• Gene Location: Start: 73912; End: 74994 Strand: -

Full Sequence      

MKKYKVTVYAICKNEEQNILKWYNSMKEADEIVVLDTGSTDNTIKLIQKNCPKIKLYQDR
ISPWRFDVARNKCLSLIPPSTDICVCTDIDETFNQGWKKSLLENWQEDTTRASYLYNWSF
DSYNKPGTTFYLNKIHKREGYKWKYPVHEILTYDGQEKEIIIPNIVLNHHPIAKESRKDY
LPLLEQSLKENKEDDRNAHYLGREYMYYEMWDKAIETLHYHLNLKSATWKDERCASMRFI
ARSYYHKGYLDEAIMWYNKAINEAPYLREPYTELGYLYYYEKNYLEAIKYLNRALKIKEK
PKTYINEESAWNETIYDVLSICYYNTHDYKKSFSNVKKALRINPLNSRLQKNYEIIKREA

Enzyme Prediction     

No EC number prediction in MGYG000002240_00612.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	7.80e-16	5	178	1	172	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	3.37e-10	240	341	7	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	3.11e-09	199	296	5	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam00535	Glycos_transf_2	4.42e-09	7	148	1	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
TIGR04195	S_glycosyl_SunS	9.88e-09	6	218	59	277	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58819.1	2.51e-119	1	357	1	357
AQS58818.1	3.55e-116	1	360	1	360
QOX65321.1	3.94e-115	1	356	1	356
QPJ85366.1	7.58e-113	1	357	1	357
CAB1239995.1	3.07e-111	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSP_A	1.42e-06	6	223	56	279	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	1.74e-06	6	223	56	279	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
6VBU_4	2.61e-06	178	356	118	313	Structureof the bovine BBSome complex [Bos taurus],6VBV_4 Structure of the bovine BBSome:ARL6:GTP complex [Bos taurus],6VNW_E Cryo-EM structure of apo-BBSome [Bos taurus],6VOA_E Cryo-EM structure of the BBSome-ARL6 complex [Bos taurus]
7MSK_A	5.48e-06	6	218	68	285	ChainA, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1],7MSK_B Chain B, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31986	9.52e-06	6	223	56	279	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	9.52e-06	6	223	56	279	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002240_00612.