CAZyme Information: MGYG000002241_00070

Basic Information

• Species: UMGS1901 sp900556135
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1901; UMGS1901 sp900556135
• CAZyme ID: MGYG000002241_00070
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000002241_1|CGC2	34841.21	8.1894

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002241	1320271	MAG	Peru	South America

• Gene Location: Start: 70150; End: 71043 Strand: +

Full Sequence      

MKISILTPTFNRAKLLDKLYTSILINSNNSNCDVEWLIMDDGSTDNTRIIVDTYIKENII
NVQYFYQENSGKMSAINELVKRCTGDLILECDSDDYLVPETFKIIEDALVQCKDMANIYA
MAFLKYDQNGNNMGNNFPEDNYESSMFDLYFKEGITGEKALVFNSSIRKKFKYRLENGEK
FVTEARLHHEMDLHYNIRCFNKKIMICEYKDDGYSKNINKLFIQNPKGYYEYFKEIFNQD
MHGVTFSKRLYIYKHYILFAVLAKQKHAIKNVKGTFNKIAVTLLYLPGKIMTNIKMK

Enzyme Prediction     

No EC number prediction in MGYG000002241_00070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	158	1.1e-21	0.8705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	5.80e-22	5	109	1	102	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.53e-19	4	170	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	6.03e-19	1	279	3	263	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04196	GT_2_like_d	3.75e-13	4	172	1	168	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06439	CESA_like_1	1.02e-12	2	105	30	130	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV38433.1	1.59e-51	1	291	1	284
QUB96199.1	2.24e-51	1	291	1	284
AMD94290.1	3.82e-51	1	250	1	244
BBM36535.1	5.10e-51	1	263	1	257
BBM50525.1	1.18e-50	1	291	1	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	1.72e-10	3	251	377	608	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.72e-10	3	251	376	607	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
5TZE_C	1.31e-08	1	103	1	102	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
3BCV_A	1.66e-08	2	102	6	102	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5TZ8_A	1.74e-08	1	103	1	102	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75042	5.75e-11	1	103	1	104	Uncharacterized glycosyltransferase MG060 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) OX=272634 GN=MPN_075 PE=3 SV=1
P47306	2.56e-10	1	106	1	108	Uncharacterized glycosyltransferase MG060 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) OX=243273 GN=MG060 PE=3 SV=1
Q8L0V4	9.80e-10	3	251	434	665	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1
P22639	1.06e-08	1	118	1	114	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2
A0A0H3JPC6	9.52e-08	1	103	2	103	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=tarS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002241_00070.