CAZyme Information: MGYG000002245_00019

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1312
• CAZyme ID: MGYG000002245_00019
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000002245_2|CGC1	28230.05	6.1216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002245	1630533	MAG	Peru	South America

• Gene Location: Start: 5820; End: 6560 Strand: -

Full Sequence      

MSIPKIIHYCWFGRNPLPPSVQKCIASWKKKCPDYEIVRWDETNTDVNENEYTAEAYKVG
RWAFVSDYFRLKVVYENGGVYLDTDVELLQSLDSLTDNYDGFFGYECGKNLIATGLGFGA
VPGNRFVRAMLEAYDGVQFIDADGNTDATPCPERNTAAVTRLGVDPSKRGQVIDNVCFLS
EEVLCPINFFTGEKKITKNTVSIHHYDASWCGEVTRRTLRLKRIIGIRLYSFLYEKLLHK
SDRWEW

Enzyme Prediction     

No EC number prediction in MGYG000002245_00019.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	98	3.1e-22	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	4.78e-24	3	134	82	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.08e-16	18	102	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.54e-11	3	134	46	188	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31225.1	9.66e-79	3	226	2	225
ACD37145.1	9.51e-77	3	240	2	237
QGH87046.1	9.51e-77	3	240	2	237
BAQ02241.1	9.51e-77	3	240	2	237
BCG31404.1	9.51e-77	3	240	2	237

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002245_00019.