CAZyme Information: MGYG000002245_00073

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1312
• CAZyme ID: MGYG000002245_00073
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000002245_6|CGC1	53531.16	6.391

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002245	1630533	MAG	Peru	South America

• Gene Location: Start: 8096; End: 9538 Strand: -

Full Sequence      

MKIVFAASEAAPFIKTGGLGDVAGALPDALSHQKGAEVLVFLPYYKSVKNNPDIKTEFLK
SFAVSLSWRVQHVGVFRLKSKKKKHQVYFIDNEYYFGKDGAYGYADDGERFAYFSKAILE
SLVQLGIKPDIIHANDWQTALIPVLLHAFYEEPLGGAKTVFTIHNMEYQGKCDPYFIPDV
LGLPESYTNTMIFGDNTNFMKGAILMSDAVTTVSHTYADEIRYPYFAHGLASIISAHAFK
LRGIVNGIDTKRYDPAADPELSVPYDIATYKDGKRAAKEALQRELGLPVRGDVPMIGIVS
RLVEHKGMGLLCGLLDELMRWDLQIAIVGTGDYAFEHDLSHAAYSHPDKLSVTLRFDQKL
ASRIYAASDFYLMPSKSEPCGLSQLIAMRYGSVPIVHAIGGLRDTIEPWNPETGDGTGFT
FQSFCALDMIDAIRRAFTLYGTDKEAFSRLIENGMRRDSSWDVPAGEYRQLYNELRPDKA

Enzyme Prediction     

EC	2.4.1.21	2.4.1.242

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	473	9.6e-167	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	472	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	476	1	464	glycogen synthase GlgA.
TIGR02095	glgA	0.0	1	475	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	1.61e-175	1	476	1	479	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.25e-111	1	475	4	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHV97681.1	3.46e-150	1	475	1	472
AKG35026.1	6.07e-150	1	475	1	472
QDH23389.1	2.44e-149	1	476	1	475
AIQ64274.1	2.66e-149	1	475	1	472
AIQ30256.1	5.24e-149	1	475	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	2.76e-83	2	472	126	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNE_A	1.07e-82	1	472	10	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	1.27e-74	1	476	1	477	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.56e-74	1	476	1	477	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.20e-73	1	476	1	477	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1YK70	9.66e-144	1	477	1	480	Glycogen synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / CIP 109462 / JCM 13490 / 255-15) OX=262543 GN=glgA PE=3 SV=1
Q1WSN1	1.54e-143	1	475	1	475	Glycogen synthase OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=glgA PE=3 SV=1
B2V049	3.76e-142	1	475	1	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	5.32e-142	1	475	1	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
A3CM04	2.60e-139	1	475	1	475	Glycogen synthase OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000044	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002245_00073.