CAZyme Information: MGYG000002246_00319

Basic Information

• Species: UBA6857 sp900555805
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA6857; UBA6857 sp900555805
• CAZyme ID: MGYG000002246_00319
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		97060.28	6.2874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002246	1721573	MAG	Peru	South America

• Gene Location: Start: 5625; End: 8165 Strand: +

Full Sequence      

MKKTLNGQWKFRQLGESVWKNATVPGCNFLDLMANGDIPDPFVGLNESKVAWVGRKDWEY
SKKFSVTDGEMRSDDILLCCKMLDTVCDVYVNERLAFHGENCFRAYNESVKNYLHSGENT
VRIVFFSPVRYVEKRYNELPAPMNSNGQNGIVHIRKPQCHFGWDWGPILPCSGITGDIEL
EFADTAKIEYLAVTQKLSNNTAVIKAKADIMGYGEYECETELISPNGKCETKQGSAAEFL
IDNPELWWTRELSGKDEQPLYTVKVIVKAHGETVDSEEKRIGIRTVELDRERDKYGRNFK
FILNGVPLFIKGANYIPPDSFITRFTEDKLEKLIDAALFSNMNMLRIWGGGYYESDEFYS
MCDRKGILVWQDFQFACQAYPFFDESFLENVREEVKYNVSRLCHHPSLAVWNGNNEIEQM
HMAWVHMKKYVDWTEKFFYGILEPEIRKYDGATPYTPGSPVGVSHNSGVDSDNVGDTHLW
GVWHGLKPMDYYRKRMTRFCSEFGFESLPDMKAIEKFAEPSDYSISSEVFKVHQKCANGN
DKMIYYIASRFDLPKRFEDLVYLSQVTQNECISDATEHWRRNKGRCNGSMYWQFNDCWGV
CSWSSLDYYGNYKALQYGARHFNSPLAVSVEDGREYIKIFALNDLRAPEKITVEYEIFDF
YKGTLESDCKEKVVGAAENLCLFEISMEGIRQKFDLKRTGLAARLIKDGKLVQQKVLLFG
KEKNLDLPKAKLKTEISKEKSGLSITLTTDAFVRLVKIDSRITSEPFSDNFFDILPGDSK
TVAIRSDGKHSIDELAESISAFSLTDIPFDKSKVRSAIKRAKVYSSPTNLANMFYHGKLS
KDAKLD

Enzyme Prediction     

No EC number prediction in MGYG000002246_00319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	770	3.2e-101	0.800531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.72e-93	1	781	11	781	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	2.81e-16	729	806	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.97e-12	186	284	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	9.47e-09	3	416	42	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	7.72e-08	188	369	184	352	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98156.1	3.17e-217	1	820	2	837
AUG59052.1	1.53e-196	5	806	5	816
AVQ95585.1	3.90e-185	5	806	6	817
ADU26456.1	3.90e-185	5	806	6	817
AYF38249.1	3.90e-185	5	806	6	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	9.61e-160	5	786	11	818	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.02e-159	5	786	13	820	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.05e-159	5	786	13	820	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.76e-159	5	786	11	818	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.15e-157	5	786	11	818	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	1.52e-111	5	785	9	827	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q29444	2.47e-111	4	806	24	877	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q95327	6.72e-111	4	806	24	877	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
O00462	1.38e-108	4	807	24	878	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q4FZV0	1.11e-105	4	693	24	760	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002246_00319.