CAZyme Information: MGYG000002247_00628

Basic Information

• Species: Acetatifactor sp900771995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900771995
• CAZyme ID: MGYG000002247_00628
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	MGYG000002247_8|CGC2	52146.53	4.7298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002247	3138747	MAG	Peru	South America

• Gene Location: Start: 25078; End: 26424 Strand: +

Full Sequence      

MRLSLEKKTGPLYWCTYEYQVTNNSYMPEDRFKDNVDWIAKNYVPYGYEMICTDGWIEDS
FCLNENGYLLKHHDTWKHDWLYWSDYCNERGLALGVYYNPLWISPKAVNDSHYKVVGTDI
PVHDITDTDYIFEGDNQSLKGDRFSYYNGDKSLFWVDVNRPGAKEYIQGYVQFFIDNKVD
FLRIDFISWYEDGYDKGTKIGRDHGVKNYRTALKWIREAAGDKIMISLVMPHLKHDGENE
FGMGSMARINEDCGTGGWLNFSDKNRGIRFDYWSQFTTPFDGLIYWSRKFYEHNMIMDAD
MLRLNTFDNDEERKSAVSLCILSGAPLDIADQYDSIGDSGWIYQNTELLGLNKEGVVCFP
LSDDIKNPESEIWTGTKTNGERIVGIFNRDNKEKECNIDFEEKIGISKGKIRDLWLKKDL
GVSDHFEAVLEPHGCRIISIIPDSARMV

Enzyme Prediction     

No EC number prediction in MGYG000002247_00628.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	171	421	4.4e-27	0.9432314410480349

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	8.65e-11	369	440	3	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
cd14792	GH27	4.47e-07	14	352	8	269	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02808	PLN02808	3.68e-05	298	442	237	385	alpha-galactosidase
PLN02899	PLN02899	0.002	360	441	540	631	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZB42116.1	4.03e-136	6	445	35	471
QST00336.1	3.11e-135	4	446	33	472
ARI79039.1	1.54e-131	7	446	37	473
AMM31909.1	2.33e-124	10	442	60	490
QQT60490.1	2.44e-123	10	440	46	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	1.73e-119	10	442	37	467	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]
4NX0_A	4.67e-13	8	442	23	442	Crystalstructure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_B Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_C Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_D Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_E Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_F Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_G Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_H Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	2.03e-119	10	442	63	493	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002247_00628.