CAZyme Information: MGYG000002247_02153

Basic Information

• Species: Acetatifactor sp900771995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900771995
• CAZyme ID: MGYG000002247_02153
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000002247_42|CGC1	36751.26	4.4682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002247	3138747	MAG	Peru	South America

• Gene Location: Start: 11986; End: 12936 Strand: -

Full Sequence      

MTTADPKATKEATELLEYLRGVAGQQIITGQHTQTIPCEEIEYIREQTGKEPKLRGFELL
AYSPNINYNDASPECLTEIEENKGTAETALQWAKEQRKPGNGGIITFTFHWFSPLGGRDK
SFYTEHTDFDAAKILQEGTPERTAFYHDMDVIAEILQSFQKENIPILWRPFHESYGTWFW
WGAKGPEVARDLYRLMFDYYTKEKDLHNLLWVWNCDIPEAYPGDDYVDVVSMDVYLPEYR
ATDYAETYEKLVTATSREKIAALAEIGYLPDIDLLQKSRIPWAYYMTWSKEFCIGEKYNS
TENLKKMYDSEYAVNL

Enzyme Prediction     

No EC number prediction in MGYG000002247_02153.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	315	1.7e-97	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.41e-50	5	289	2	283	Glycosyl hydrolase family 26.
COG4124	ManB2	8.95e-17	122	268	137	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	9.02e-207	1	316	6	334
CBK82137.1	1.17e-167	4	314	5	310
AEB13973.1	1.28e-154	3	316	4	310
AZK45707.1	6.33e-134	1	316	4	314
AOZ93051.1	6.40e-125	2	316	8	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.01e-64	2	314	5	305	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	1.60e-60	5	316	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	2.46e-49	6	316	37	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	2.93e-40	8	288	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	4.95e-36	4	291	5	311	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	3.19e-62	5	316	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	2.65e-56	5	316	30	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	8.39e-54	4	311	147	449	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	8.95e-52	5	316	30	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	2.88e-40	2	316	156	457	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002247_02153.