CAZyme Information: MGYG000002248_00410

Basic Information

• Species: UBA5026 sp900552335
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA5026; UBA5026 sp900552335
• CAZyme ID: MGYG000002248_00410
• CAZy Family: CBM50
• CAZyme Description: Peptidoglycan endopeptidase LytF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
131		14396.31	8.2741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002248	1289678	MAG	Peru	South America

• Gene Location: Start: 27577; End: 27972 Strand: -

Full Sequence      

MQEIMDFNNLGSTILTVGQVLKIPVAYEEEIPSTSEVTYTVKSGDNLYSIAKKYNVTVSD
LMNYNNLTSNLLSIGQVIRIPSNTSSSTAYTVKNGDTLYSIARKYNTSVDSIKTKNNLTS
NTLSIGQKLII

Enzyme Prediction     

No EC number prediction in MGYG000002248_00410.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	39	81	1.6e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	5.17e-23	7	131	433	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	5.88e-21	33	129	340	444	membrane-bound lytic murein transglycosylase D; Provisional
PRK06347	PRK06347	4.61e-17	7	129	358	521	1,4-beta-N-acetylmuramoylhydrolase.
pfam01476	LysM	2.19e-15	39	81	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK06347	PRK06347	3.83e-15	33	129	327	447	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS76557.1	3.44e-27	8	131	265	395
ANU19959.1	2.49e-26	8	131	265	395
ANU17773.1	2.49e-26	8	131	265	395
AUD14380.1	2.49e-26	8	131	265	395
QNR20137.1	3.18e-26	11	131	221	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	1.04e-09	36	82	2	48	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4B8V_A	5.05e-09	33	131	38	160	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
4XCM_A	3.82e-08	35	82	1	48	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
2MKX_A	2.84e-06	86	131	3	48	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07532	5.41e-22	3	131	197	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O31852	2.16e-18	8	131	55	200	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P54421	9.16e-18	3	129	49	190	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
Q49UX4	1.65e-17	38	129	28	127	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q8CMN2	1.10e-15	3	129	50	188	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002248_00410.