CAZyme Information: MGYG000002249_00342

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA5026
• CAZyme ID: MGYG000002249_00342
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
983		109582.75	8.6373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002249	1261988	MAG	Peru	South America

• Gene Location: Start: 4097; End: 7048 Strand: +

Full Sequence      

MKDFFKNKDNLIILGISLVAFLVGCLAIGPLLSILIIGVADVLFFLPNFINKKPTTRKKE
GITNMKKEKPIHQKKKNKKIWKKILMVFLILCILGIITCIGFAAYIVIEAPKFKPDDLYK
MEPTVLYSSDGTEMAHLGSEKRDNITYDDLPEVLVDAIVATEDSRFFQHNGFDLARFLKA
SIQQVLTGGGGGASTLTMQVVKNTFTSTTSSGFEGIKRKFTDIYMSVFQVEKKYTKKEIL
EFYVNSYYLGSGSYGVEQASKTYFGKSAKDMNLAEAAMIAGLFQAPNAYDPYQHPEKAES
RRNQVLKLMKRHNYITEEEYQAATSIKVEDMLVSKDGSNSDNEWQPFIDVVVEDVIEYFK
EQGKKVNPYTTSMHIYTTMDKDKQSWINNVMDGKTYTWQNDIVDAGISVQDVNTGAIVAI
GAGRHRTGERQRVNATQIKRQIGSTSKPLYDYAPGIEYENWSTYQLFVDEPHGYSNGTQI
NNWDRKYNGLMTMRTALAQSRNIPALKAFQSNKNSNILKFVQSVGLHPEVSDGIVHEAHA
IGGQSYGENPRTMAAAYASFGNGGYYIKPYSYTKIVLNETNETIETKVEKTKVMSEETAY
MMTSMLQSSAQAGLGNQYYVNGAIYGAKTGTSNYPENIAKKFGENSVNDLWVNAVSPDYA
ISVWYGYQDLNRTVTSTSYTIAHRTLFQAVAKGVFKTGSNWTKPNSVSEVQVEMGSWPAK
LPSEYTPSDMVVTELFKSGTEPTEVSDRYSKLSDVTDLKSSITNNKLTLKWTAIKTPNAI
DTDYLNQYFSSLYSDESYRQNALSTRLSQNNSFYGKLVYKIYGKDSSGKLNYITETSDST
VTIDVNTSSPTTYVVKSSYTIFTANASDGVSTTVNLENVKGTVTAKLNGKESEEIKKGTT
YKVSTSDITVLEDSKDVTSKAKITITIDGNKITGTSETLDTTVVKNHSIQYSIVYDNQPI
KSITKTVKVVENSSNTNNSTKTQ

Enzyme Prediction     

No EC number prediction in MGYG000002249_00342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	130	310	5.1e-59	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	5.04e-150	85	689	18	592	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.51e-102	85	751	9	773	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.63e-74	130	310	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	1.69e-65	99	742	9	602	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	8.73e-64	114	669	124	659	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU34821.1	9.54e-148	73	825	24	764
QSB47366.1	9.54e-148	73	825	24	764
QIQ33945.1	9.54e-148	73	825	24	764
AYA76804.1	2.50e-146	78	762	31	712
ANZ31353.1	1.09e-144	73	829	24	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	6.86e-91	123	708	7	603	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	9.75e-87	109	708	2	612	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	7.04e-58	229	678	2	445	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.86e-52	229	678	2	445	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
5U2G_A	2.75e-42	122	575	20	555	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	2.40e-124	73	771	26	727	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	4.67e-102	79	682	8	615	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	3.88e-96	88	707	17	640	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	1.44e-95	88	707	17	640	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
Q891X1	2.84e-67	71	750	4	714	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999216	0.000792	0.000007	0.000005	0.000002	0.000020

TMHMM  Annotations     

start	end
15	49
84	106