CAZyme Information: MGYG000002250_01751

Basic Information

• Species: CAG-110 sp900554705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900554705
• CAZyme ID: MGYG000002250_01751
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000002250_97|CGC1	45924	4.2956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002250	2091034	MAG	Peru	South America

• Gene Location: Start: 178; End: 1419 Strand: -

Full Sequence      

MKRLIVILSVVLAILIAVALFLFLPRGEKPASPTRASATTAPRQTTQATEAPTTTKPEAP
TTEASTEPPTEPLPEMLVQEPAMVLAGKAVESWWIDGRHYIAAPAFADALGMTLEATQPS
VRMHTAHDTLEVTAERITANGTSVDVQDGVCTVSEQTYILFQECVEALGYPTLYDEEYDV
TYITPAARPFEIPQGVNVPVLMYHAVNDDTSWGSAELMVSPSTLEEQLQYLLDNGYDPIW
FEDLAYLDEYDKPVILTFDDGYLDNYEYLFPLLKKYQVKATVFIIADHMGMSHKATPEQV
REMAQSGVVSIQSHTFTHEYLSNLSRSAQEDQMRLSRLKLARTTGLVPYVLCYPTGMYNG
DTLELGPQYYLFGIKMNGGLYNTSDDPFLVNRYYVSRYTGLDTFAAYVASAGT

Enzyme Prediction     

No EC number prediction in MGYG000002250_01751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	251	364	4.2e-30	0.823076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	2.16e-44	253	397	1	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	4.39e-36	221	404	1	210	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	1.11e-32	251	365	6	115	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
COG0726	CDA1	3.60e-29	199	371	2	180	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10966	CE4_yadE_5s	6.96e-29	251	404	2	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABO51554.1	1.52e-27	198	404	48	272
AFC32947.1	1.64e-26	183	404	20	244
AFH65258.1	1.64e-26	183	404	20	244
AZW09993.1	2.80e-26	198	404	13	236
AYZ74127.1	2.80e-26	198	404	13	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GO1_A	2.52e-30	197	408	99	317	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
4HD5_A	1.83e-28	198	406	144	357	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
4V33_A	4.77e-28	165	406	119	357	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
6DQ3_A	4.30e-25	196	392	7	212	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
4U10_A	2.55e-12	200	403	6	258	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	8.67e-32	198	410	65	277	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P31666	7.69e-11	200	410	172	405	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
Q8XAR3	2.66e-09	201	384	52	282	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1
P75906	2.66e-09	201	384	52	282	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q9RQP7	1.36e-08	219	397	77	268	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991466	0.008173	0.000193	0.000069	0.000032	0.000076

TMHMM  Annotations     

start	end
5	24