CAZyme Information: MGYG000002251_00164

Basic Information

• Species: RQCD01 sp008668455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; RQCD01; RQCD01 sp008668455
• CAZyme ID: MGYG000002251_00164
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729		82511.13	5.0477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002251	1374022	MAG	Peru	South America

• Gene Location: Start: 1833; End: 4022 Strand: +

Full Sequence      

MEKKFIKATKEYCTYEKHVAAPYFRRTFSLDFVPEQADIKICGMGFYRLFVNGTEITKGM
LAPYISNPDHYCYYDSYDAATYLKKGKNAIGVILGNGFFNSFAGGVWDFDKGDWRGAPVL
ALEFFAKAGEQELAFGADEQFLVHPSPILMDEERLGEIYDANREIPGWCDPEFDDGGWMP
ALSADTPRGDFKLCTAEPIRVIEELKPIRITREGDAFLYDFGENNAGVCRLQIRAKKGQE
ISLQHAEELIDGKFSTKYIMYGRKEDSHFQRDIYIAKGEGAETHIPSFTYHGFRYVLVEG
ITGEQATPELLTYLVCRSDLRTIGGFSCSDEMANKIFDICRRSDLSNFYYFPTDCPQREK
NGWTGDVSMSADHMARLYDVQKSFREWLCSIRRAQNEQGALPGIVPTAKWGYAWGNGPAW
DSVLFNLTYQLYLVYGDLEAVRENAHAMLSYLDYAMSKRNERGTVQYGLGDWAPPGRQNH
ESPAPVEFTDSVMIMDIAGKCAKMLKAIGNTHGAAYAQGIYEDMRETIRRELVDFSTMTV
TGNCQTCQAMAVYYDVLDEDEKPAAVKHLVSLIHENKDHFDCGYLGLHTIFHVLSDFGYA
ELAYQMITTPDYPSYGHFVVTGETTVPEHFHPDGQPLGSHNHHFFCDVERWLMEDVAGLH
VIDSEHVEVKPNFIQKLDSASAYSEIPKGRVSVSWERKGEEIYLNVVSPVDYQLTLPKGQ
KIILNGGTK

Enzyme Prediction     

No EC number prediction in MGYG000002251_00164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	211	715	1.6e-126	0.9861111111111112
CBM67	17	185	9.7e-27	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.53e-75	321	656	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.79e-36	34	203	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.68e-22	210	315	1	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.007	666	710	11	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	2.03e-137	16	716	138	838
ANH83620.1	1.07e-129	21	722	140	847
SCM59042.1	1.78e-129	14	722	147	861
QGA23306.1	2.65e-126	16	723	156	867
QDM10804.1	7.32e-126	18	727	159	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	9.09e-96	21	711	176	891	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.50e-73	24	701	134	822	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	2.66e-69	20	709	301	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
2OKX_A	2.64e-06	47	183	50	178	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.60e-78	20	728	183	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	3.85e-71	19	709	167	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.31e-68	20	709	301	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.34e-68	23	709	176	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002251_00164.