CAZyme Information: MGYG000002256_00726

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3282
• CAZyme ID: MGYG000002256_00726
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796	MGYG000002256_13|CGC1	91197.31	5.5735

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002256	2755304	MAG	Peru	South America

• Gene Location: Start: 4109; End: 6499 Strand: +

Full Sequence      

MSGQTEKDWASFYEAAYERQKRHNHMLAAKLAEAETKQGELEQKVNRICGSPFWKITAPV
RKWNHLTDGIGRRRRQALEEQPSEADLSAYTQELERQQDPYLQWIRQMEGEETIEAGVPV
GEKEDGIWILPVPDTDLLLVGYGKGFLATNTDEKVKTYFNNYPDCLLAYPDEDFYWKNVQ
HRMEPWMKPCYSPDTLLSFNCMGHLVAVRTELAERTGLTCLVEAGKGKDTDAVFYDLCLR
LEENSRWDSLHVIPGVFQEPVKIGHIDAVLFHQEYRLPDGEEESFANARRHLQETLEAGE
YLTGAGESCLAVRQEALSRRGIRAFLQEGPDPGIYHVVYDTAISGRERCNRAMNSRSTDQ
THFLVSVIIPSKDHPDILENCLVSFLTKTAYANVEFVIVDNGSSAENRRKAERELRKKLE
KLWTDQEREEKLSFHYIYKEMPFNFSKMCNLGASKAAGDLFLFLNDDIEIIEESWLDRMV
GQALQPHTGAVGARLWYAGSERIQHAGITNLPIGPSHKLITFLDDRDYYYGHNRVSYDMA
GVTGACLLVAKDRYEQVGGMDETMAVSYNDVDLCFKLLEAGYYNVLRNDAVLYHHESLSR
GLDEQDGGKWKRLLAEKDRLYEKHLLFKGKDPFYSKALIGNASDYRCAFQFAHEQQLATV
EPERIEPKQLKRRKEEMLRLTVDRAEPQHKIYLDEPDILWIMGWSYLPGADNAAFERKLL
LQRADGVLYQADPALWNRKDVEKILPMEKHVGLAGFVLRVLKKDLEPGEYRVGMLAQSGA
GKGGFLAWSDKTLRVE

Enzyme Prediction     

No EC number prediction in MGYG000002256_00726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	366	527	5.2e-17	0.8117647058823529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.17e-32	367	596	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.07e-22	365	601	5	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04184	GT2_RfbC_Mx_like	2.01e-15	159	272	108	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	4.36e-13	366	535	1	158	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	4.40e-13	367	496	1	115	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02107.1	8.36e-107	145	776	61	648
AVK48684.1	3.21e-103	147	778	794	1344
QUF73846.1	4.12e-102	147	778	794	1344
ABR36854.1	4.12e-102	147	778	794	1344
AIU02421.1	4.12e-102	147	778	794	1344

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.47e-40	162	645	476	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	5.21e-39	163	644	430	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002256_00726.