CAZyme Information: MGYG000002256_00727

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3282
• CAZyme ID: MGYG000002256_00727
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690	MGYG000002256_13|CGC1	79215.9	6.1649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002256	2755304	MAG	Peru	South America

• Gene Location: Start: 6469; End: 8541 Strand: +

Full Sequence      

MVGQDPAGRVRNEKETTKVEENVEQREKDEMSRQDRLRHYRQAYERERQKEEILSGKLDQ
AQQKNADLTARLTRIKGSGLWKLSKPLRDAIHWLQRTRERLGYYGSIKGIVRKLQSKSIE
RKARARYGKASFPDAEEARRQRETKFDTDVTFSILVPLYNTPEKFLRQAIESVLAQTYEK
WQLCLADGSDDAHEEVGRICREYANADAAGRISYEKLEKNEGISGNTNACLSMARGNYIA
LFDHDDVLHPSVLYEYMKAICGQNADYIYCDEATFHGNKSIDDMITLHFKPDFAPDNLCA
NNYICHFSAFKRTLLDGTELFRSQFDGSQDHDMILRLTSRAEHVVHVPKLLYYWRSHAGS
VASDINAKSYAIDAAKGAVADHLRRQGWENFEITSTKAFETIFRIKYEILGNPKISIIIP
NKDHLDDLKRCITSITEKSTYDNYEIIVVENNSVTDEIFAYYEELKKNPDIHIVTYEGDF
NYSAINNLGERHATGEYVLLLNNDTQVITLDWMEELLMYAQRSDVGAVGAKLYYEDNTIQ
HAGVVLGLGAHRTAGHSHYRVSSNNLGYMGRLCYAQDVMAVTGACLMMRRSLFEELGGLD
ESFAVSLNDVDLCIRAWKAGYLNVFTPFAELYHYESVSRGLDDQGEKAQRYNRESEAFRA
RWKELLDKGDPYYNPNFSLDRSDFALRTDI

Enzyme Prediction     

No EC number prediction in MGYG000002256_00727.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	416	597	1.9e-24	0.9941176470588236
GT2	153	274	2.1e-23	0.6882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.35e-79	152	355	3	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	6.38e-49	417	635	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.25e-34	411	640	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.15e-22	153	315	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam00535	Glycos_transf_2	1.92e-20	416	593	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33299.1	6.68e-317	40	689	6	674
AOZ95572.1	3.80e-309	40	689	6	676
QNM02106.1	3.18e-296	40	687	6	678
QUO22278.1	1.80e-291	64	687	6	629
CAB1243278.1	1.03e-250	31	687	376	1033

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.12e-124	153	686	369	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.17e-86	153	687	322	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	1.05e-12	153	504	16	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q4UM29	3.73e-12	153	515	17	398	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q92IF9	1.98e-11	153	515	17	398	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002256_00727.