CAZyme Information: MGYG000002256_00858

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3282
• CAZyme ID: MGYG000002256_00858
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000002256_16|CGC1	36095.49	4.6213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002256	2755304	MAG	Peru	South America

• Gene Location: Start: 23895; End: 24830 Strand: +

Full Sequence      

MKPVNAQATAEAVGLLEYLYETAGKKIITGQHTQTVPMEEAEHIFQSTGKRPKLQGFELL
AYSPNINYDVTSPECMKEVEENRETVDAALKWAEETKGIVSFCFHWFSPIGGKDKSFYTE
HTDFDPEQVLKEGTPEREAFFHDLDRIATELRRFQEKRIPVLWRPLHESEGTWFWWGSKG
PEVARDLYRLMYRYYTDELHLDHLLWVWSCPTKEGYPGDDCVDVIGRDVYVPAHTSTDYE
AEYRELMENTGSTKVAALTEVGILPDVDLLQKSHIPWAYYMTWSKEFCIGEDHNYDSELK
KIYASDYSVTL

Enzyme Prediction     

No EC number prediction in MGYG000002256_00858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	311	9.4e-92	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.20e-52	4	310	1	308	Glycosyl hydrolase family 26.
COG4124	ManB2	2.65e-14	159	230	180	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	6.77e-154	2	310	3	311
QNM01251.1	7.79e-151	1	311	6	334
AEB13973.1	1.14e-137	1	311	2	310
AZK45707.1	3.37e-125	3	311	6	314
AOZ93051.1	2.91e-117	3	311	9	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	7.60e-63	3	310	6	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	3.12e-58	5	311	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.08e-49	3	311	34	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	3.74e-39	8	283	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	6.16e-33	1	310	21	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.49e-61	5	311	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	4.60e-52	2	311	27	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.09e-50	5	310	148	453	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.21e-42	4	311	29	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	7.24e-42	4	303	158	449	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002256_00858.