CAZyme Information: MGYG000002257_01734

Basic Information

• Species: UBA737 sp900547305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737; UBA737 sp900547305
• CAZyme ID: MGYG000002257_01734
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		84808.9	4.9172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002257	2338223	MAG	Peru	South America

• Gene Location: Start: 8246; End: 10504 Strand: -

Full Sequence      

MLYPNTFISAGEEYADIGHFVSAPFFRKKFTAEKIKTAEIVIGAVGFYRLFINGKDITKG
FLAPYISNPDDIVYYDRYDVSGLINEGENIIAVLLGNGLQNNPGGAIWDFDKAPWRGAPS
FALRLDMTDFGGNITAIESDESFKVCNSPILFDDYRCGEYYDARLEISNFHTADFDDLGF
KNAIKAPTPRGGKRLCTADPVRIYGELKPVSVTRCENGWLYDFGENNTGVCRLSVNAKAG
QKITLRYGEWLKDGKLCLDNIRFAQQSDLQKDFVQKSEYICRDGNQTHTPSFIYNGFRYV
LAEGITEEQATENLLTYLKMSSLPNCAGEFTCSDEVINKIQEATVRSDISNFNYFPTDCP
QREKNGWTADASLSAEQMLFNLYPEKCYKEWMHSIYKALSDNGQLPGIVPTAGWGYEWGN
GPAWDNVIINLPYFTYKYRGDREILEELSAPLMRYLNYLFSRLGEDGIMEIGLGDWCPPG
VKEDEFKTPLAVTDTILTYDIAVKSAFVYEVLGQEPQRQFALALAERVKAAFREKLLNKE
TGEIKGGTQTGQAMAIYYGLLTEEEKSKALKLLIKYIDDENGHFYTGVLGGRVIYRVLAE
NGYVDLAYNMIVRPDYPSYGNWIKRGATTLWEGFYPEGGRVLSLNHHFWGDISAWFYTYL
AGIKINPTGRDVTNVDIAPLFPEKLRNVSARYYTPNGRISVAWGRTDENSVVLKITAAEK
LHGKILLPEGFAFEDGTHETELKSGEYGLKHV

Enzyme Prediction     

No EC number prediction in MGYG000002257_01734.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	217	725	5.2e-121	0.9821428571428571
CBM67	22	185	5.1e-26	0.8636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.76e-82	327	660	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.23e-34	34	203	2	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	8.65e-17	219	314	8	96	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.007	677	716	14	52	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	1.72e-155	21	750	141	879
AHF16194.1	1.57e-150	15	728	164	862
QEL04107.1	1.93e-146	3	742	166	899
AMR32219.1	1.42e-145	23	730	152	856
QEC78322.1	2.01e-144	23	750	161	888

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.66e-105	23	746	176	920	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.36e-70	33	703	314	971	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.91e-60	26	703	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.87e-83	22	703	183	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	6.86e-76	25	728	176	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.13e-75	25	752	172	911	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	3.13e-69	33	703	314	971	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002257_01734.