CAZyme Information: MGYG000002258_00805

Basic Information

• Species: UBA1081 sp900543395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1081; UBA1081 sp900543395
• CAZyme ID: MGYG000002258_00805
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1092	MGYG000002258_11|CGC1	124046.76	5.2497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002258	2308524	MAG	Peru	South America

• Gene Location: Start: 58197; End: 61475 Strand: -

Full Sequence      

MSADNINEALKYLKRRSAELKELLGEFGVSLDEKENAVYFNTDKKSLKDLKVAAIADAFT
RGNFESECNFFSLTCSDWKNEIDSFNPDLLFIESAWNGKNNSWYKKIANGSKELYELSEY
CRSKRIPIVFWNKEDPVFTDVFMSAASCADYVFTTDIDCVAKYKKSLNSDNVYLLHFSAQ
PRVHNPLEMHVRKDKFCFAGAYYHKYKERCRVFDDFADVFESTKGLEIFDRNFKNPRPEH
AFPARYNKMILGSLSPDEIHIAYKGYNYGVNMNSVNASQSMFARRVFELLASNTITVGNY
SRGQRNFFGDLTISTDNSNELKRHLDKYCCDEESTRKFRLAGLRTVLSYHLCEDRLGYIA
GIVFGRDMKKKLPGITLYSYCETGEEVSNTISSFARQTYKNARLYIITDVDFTESDERVK
RIGTDEASSAEFPVNGFIAAMNPRDFYGENYLYDLVLSVRYSSLDGFGKADTYKNENGEV
SIASRENTYRECSSFNSNAGIVRPSAVKCDVLSFAKGVKLDGKFLCTDEFNYCENGGQSC
EKCGDMFIADKGIELHKLEKLAENIKPGEDDSIYINYGPVELNNAFRKYTNKKVLYFAAD
GKTGVDSKMSEGEKSEPVIAKELKLSEHGIQNNISIVCACAGDLAVNIKCDVLDSSKRVI
TSEVSTDMPFLSADIPAGGEYVNISLVITGSGNTEISSVRIGSDINIYEDMPFVSRNDTL
VLAPAYPSYDDLYKYMYIHRRLKAYKNYAYPADAAAIGADVKAEFREYDGIDVVSGNADR
LVSILENSNIKNIFIHFLDPYIWSIIKPYTDSFNIFIWSHGFDIQPWFRRKYNFETDREL
EKAKEQSAVREKMWREVFECSKTDNIHFVFVSEYLKNTVGEDYGVEFTDKNSSVIHNCID
TSLYSYEKKPKEQRFKILAVKSFANNNYANDVMTKAIAELSKYDEFKDMTFDIFGDGEKF
DITYSALKRYKNVNMNRRYLSPYDIADEHKTHGIFLCTTRMDTQGVSRDEAMSSGLVPVT
NAVAAVPEFVDDNCGILAGAEDYKGIADGILRLVRDEKLFEKMSENAAKHVREISSVESE
VPKELGLIAIGC

Enzyme Prediction     

No EC number prediction in MGYG000002258_00805.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.89e-19	793	1073	86	350	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG4641	COG4641	1.43e-16	82	363	73	359	Spore maturation protein CgeB [Cell cycle control, cell division, chromosome partitioning].
COG0438	RfaB	1.41e-15	746	1073	22	359	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03820	GT4_AmsD-like	2.08e-12	890	1069	159	335	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
pfam13692	Glyco_trans_1_4	1.32e-11	914	1056	1	138	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY81850.1	0.0	6	1088	7	1099
ALS25943.1	2.90e-248	47	1088	50	1097
QIZ83336.1	4.58e-248	47	1088	231	1284
SPS06591.1	9.99e-248	46	1087	441	1500
SDS87966.1	1.74e-247	50	1087	556	1608

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002258_00805.