CAZyme Information: MGYG000002258_02011

Basic Information

• Species: UBA1081 sp900543395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1081; UBA1081 sp900543395
• CAZyme ID: MGYG000002258_02011
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512		58603.43	4.8113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002258	2308524	MAG	Peru	South America

• Gene Location: Start: 661; End: 2199 Strand: -

Full Sequence      

MIDILRIPDYIKITCDSDKNDASVRFVIGEGMKVFVSCSDSGVKYVDLRWKFDTETPVSV
MSDSWERLYNDAEWGALDSERHLPWYFIAKDGEDNFTGCGVRVLPNSFACFSYDASGVTC
RLDVRCGGMGVKIDGELQAAEILCRSYTDIGAYEACREFCNLMSPNPVLPEKPVYGSNNW
YYAYGKSSYNEIMNDARLLASLTEGLENRPFMVIDDGWMINSCAGPWIPNDKYGDMKKIA
DEFKALGVRPGIWIRPLHDIQAEKEHPEWLINRADCRFLDPTVPEVKRKIAEDVSRIYTW
GYELIKHDFSTFDLFGRFGFEMNSLVTKEASWAFYDRSKTSAQVVKELYNLIRCNAENAV
IIGCNTLGHLCAGIFELNRTGDDTSGERWARTRKYGVNSLAFRMCQNKTFYMCDADCVGI
LDKNIPWSLNRQWLDLLAKSGTPLFVSVQPESMTDEIREDLKNAFKIASKQADETFPVDF
EFNKHPRIWSINGKTVKYDFYMSDGWDVQTER

Enzyme Prediction     

No EC number prediction in MGYG000002258_02011.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	9.06e-33	172	470	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	2.23e-09	146	275	10	148	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	0.006	212	256	37	80	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL19648.1	7.52e-157	5	505	28	544
QCU01578.1	3.44e-155	5	505	28	544
SNU96820.1	5.54e-150	1	511	5	533
ANE49069.1	2.47e-147	46	501	10	474
QGQ95278.1	4.30e-147	28	500	43	519

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002258_02011.