CAZyme Information: MGYG000002261_01101

Basic Information

• Species: CAG-841 sp002479075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-841; CAG-841 sp002479075
• CAZyme ID: MGYG000002261_01101
• CAZy Family: GH156
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503		56958.82	5.1283

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002261	1427918	MAG	Peru	South America

• Gene Location: Start: 860; End: 2371 Strand: +

Full Sequence      

MGLIFNEDPNHFVYTRAQAGVTELSEKELTDFIDGYAGTNITDFLICVNASLPHFRTKTI
ESVCDKYRAWEKAGKLSGRENDPIIKSTRLLCETLDKGLDIHSIWIDRLRKNGIKPWISV
RMNDIHNAGDEDAFLPSGFSRSHPEYLRAGYRTPSGYYEYALDYTFPEVREYYLSVISEA
LETFDADGIELDFMREIYCFGVGREYAGIEIMTDFIEKAVALVRRFEEVRGHRINVGIRL
PDSPEKALRLGFDAVEWINRGYFDLITVSPRWSSADSDMPIDFWKRLLRGKKIRLAAGLD
VLLDAYNRRGRKYLFGTAESSLGMACAYTAMGADDIYLFNFMDIIDQVDAESKPLFEKSN
YRKFLCTIGDAEKQSASPRRYIVTYSDTSAVGLPSRRPLPITVGSGFSALRIPTGTVPGE
KIARLIIGTECKPEFTGDKITVYANAKRCAFAGEVPPPELAYGDMRYFAYEIDLPQALPI
VTEAEFSSPDENIKIHWAEIQIK

Enzyme Prediction     

No EC number prediction in MGYG000002261_01101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH156	2	461	2.5e-97	0.8152173913043478

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.13e-09	106	201	71	160	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd11337	AmyAc_CMD_like	0.002	156	197	107	157	Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins. Cyclomaltodextrinase (CDase; EC3.2.1.54), neopullulanase (NPase; EC 3.2.1.135), and maltogenic amylase (MA; EC 3.2.1.133) catalyze the hydrolysis of alpha-(1,4) glycosidic linkages on a number of substrates including cyclomaltodextrins (CDs), pullulan, and starch. These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Since these proteins are nearly indistinguishable from each other, they are referred to as cyclomaltodextrinases (CMDs). This group of CMDs is mainly bacterial. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PWL98936.1	1.48e-170	3	502	4	510
AYA93387.1	8.76e-87	2	503	8	501
RAV19586.1	3.80e-81	2	436	3	431
QOY88011.1	4.84e-79	3	500	27	506
BCS36836.1	2.49e-77	2	459	29	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZD_A	3.76e-88	2	503	8	501	Crystalstructure of an inverting family GH156 exosialidase from uncultured bacterium pG7 [uncultured bacterium pG7],6RZD_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 [uncultured bacterium pG7],6S00_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-acetylneuraminic acid [uncultured bacterium pG7],6S00_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-acetylneuraminic acid [uncultured bacterium pG7],6S0E_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-Acetyl-2,3-dehydro-2-deoxyneuraminic acid [uncultured bacterium pG7],6S0E_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-Acetyl-2,3-dehydro-2-deoxyneuraminic acid [uncultured bacterium pG7],6S0F_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with 3-Deoxy-D-glycero-D-galacto-2-nonulosonic acid [uncultured bacterium pG7],6S0F_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with 3-Deoxy-D-glycero-D-galacto-2-nonulosonic acid [uncultured bacterium pG7]
6S04_A	5.74e-83	2	503	8	501	Crystalstructure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-glycolylneuraminic acid [uncultured bacterium pG7],6S04_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-glycolylneuraminic acid [uncultured bacterium pG7]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002261_01101.