CAZyme Information: MGYG000002264_00201

Basic Information

• Species: UMGS363 sp900550695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900550695
• CAZyme ID: MGYG000002264_00201
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595	MGYG000002264_3|CGC1	68300.8	5.1987

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002264	2273272	MAG	Peru	South America

• Gene Location: Start: 23273; End: 25060 Strand: -

Full Sequence      

MPTSINAKNARLLPGLFKERADVNRAYLMELKTEDLLQNFYLEAGIRTDRDVTEMHLGWE
SPTCQLRGHFLGHWLSAASMLIAQNNDRELKAKLDIIIDELERCQKLNGGRWIGSIPEKY
FDKLANNEYIWSPQYTMHKTLLGLYHSAMYARNEKALSILDNAADWYIDWTAEMENKNPH
AVYSGEEGGMLEVWAGLYQLTGSEKYLTLANKYSHPSIYKKLADNGDPLSNCHANASIPW
AHGAAKMYEITGDENWLGLVKLFWKCAVSDRESFCTGGQNSGEFWIPPHKLGMFIGERTQ
EFCTVYNMVRLADYLFRFTGESEYLDYIEKNLYNGFLAQQNKFTGMPAYFLPMRSGSTKK
WGSKTHDFWCCHGTTVQAHTIYPQLCWYEDGDRLITAQYINSEYKKNENVTVTQSVDMKY
YNDGASFDEHDDSRMSRWYIKLNVNAAAPEKFTLSLRVPSWTDGEPEIYINGERCDKKAE
NGFISFDRTWNNDTVNIYFPAALSTSSLPDMPQLTAFSEGPIVLAGLCGKDCGIYMNDSS
PESALTYTTEHTYSTFPWQQSVYRTLNQPENFDLVPLYDITDEKYTVYFTKKSTN

Enzyme Prediction     

No EC number prediction in MGYG000002264_00201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	11	525	1.5e-162	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.35e-109	9	525	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.48e-73	24	531	26	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17727.1	0.0	1	595	1	597
ADL50077.1	5.56e-265	5	591	5	602
QTE68365.1	4.35e-239	1	590	1	600
ADU23130.1	2.99e-234	6	592	6	602
QUA54004.1	1.40e-230	1	590	1	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.29e-70	8	593	31	652	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.12e-66	8	593	31	652	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	3.57e-11	74	523	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.88e-10	74	523	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	2.30e-09	74	484	81	520	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.26e-08	74	484	81	520	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002264_00201.