CAZyme Information: MGYG000002266_00704

Basic Information

• Species: UMGS1864 sp900555835
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1864; UMGS1864 sp900555835
• CAZyme ID: MGYG000002266_00704
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000002266_9|CGC1	26628.45	6.2705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002266	1508921	MAG	Peru	South America

• Gene Location: Start: 46912; End: 47607 Strand: +

Full Sequence      

MLKVIKRFILLILVIAILITAYIAFEGYSMYEKAIATTSLTDKIEQIKSEENYTKLNDIP
EIYQNAVIAIEDHRFKEHNGFDFVATCRAIVANVIDGEFSQGGSTITQQLAKNLYFTQEK
RFTRKIAELFVAFDLEKNYSKDEILELYINTIYYGKGYYGIANACEGFYKKKPSEITNYE
ATYLAGIPNAPSIYSSERHSELAKKRQKQVLNAMVKYEYLTQDEANKIYNE

Enzyme Prediction     

No EC number prediction in MGYG000002266_00704.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	45	215	2e-62	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	7.73e-75	53	215	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	9.36e-69	53	227	78	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.84e-64	31	231	43	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	8.01e-44	55	231	70	246	penicillin-binding protein 1a; Provisional
PRK13481	PRK13481	1.35e-42	41	226	35	226	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET89048.1	2.20e-78	5	228	7	230
QRP41835.1	1.41e-76	13	225	15	227
ASN93505.1	1.41e-76	13	225	15	227
QJU22158.1	2.83e-76	13	225	15	227
QUO38940.1	5.15e-76	3	228	6	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.62e-40	53	231	22	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	7.37e-40	53	231	22	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	4.85e-36	35	231	41	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3VMQ_A	7.36e-36	35	231	58	260	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.05e-35	42	231	12	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87579	1.00e-44	48	231	65	248	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	2.59e-44	48	231	65	248	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
Q5FAC7	2.59e-44	48	231	65	248	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
P0A0Z5	2.59e-44	48	231	65	248	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
O05131	2.59e-44	48	231	65	248	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.975708	0.014086	0.008886	0.000074	0.000043	0.001217

TMHMM  Annotations     

start	end
7	29