CAZyme Information: MGYG000002267_00477

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_00477
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	MGYG000002267_1|CGC8	97388.29	4.869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 490969; End: 493539 Strand: +

Full Sequence      

MQKGGFMSTFTYYKDRQRTISFPVGGLGTGSIGIAGNGCLIDWQVYNRPAMGTRNGYSHF
AVKAQDETGLLDARVLVSDLEKPYMGQVDEKTMLGMPHFRELVFEGRYPVAELSFLDERF
PGKVTIRYYNPFIPLNDKDSSIPGLFADLIVENTTDHTIRYTAAGVVTNPNKGRCTSNHY
FEDGRVKGIRFVTDGMDEKDVSYSDFTLATDSEEVSYQEYWFRGNWRDHVETYWREFASC
KPLPNRHYEAGIADYKDTGILCASQVIAPGEKKEFHYILTWNVPNCSNYWSGLDISTSNI
HYDVCDRTPWKNYYAVLFQDSRASAAYSLENRPRLLAETREFMDAMYSTSIPEEALDAVT
ANLAILRSPTCLRLEDGSFYGWEGCFDDVGSCEGTCTHVWNYAYALPFLFPALSRSIRDL
EYTYSQQKDGGLEFRLRLPLGSTGRRFHSCVDGQLGSVMLIYRDYKISGDRQWLEGKWEK
IKKAVAYAWSEENTDAWDRKKQGVLDGRQHHTLDMELFGPNAWLQGFYVGALYAAAEMAS
VLGDREAEAEYGQLAEKGKEYLNRELFNGEYFYQKIDVRDSSIAERFQAGSDYWNEEKGQ
IKYQIAEGCGIDQLLAQWHANLCGLPEIFEEEKARTALASIFHYNYKPALGDIYNPWRIF
AIDEESGVIMCEWPEGTDKPAIPLTYAQECMDGMQYQVASHMIQEGMTEQGERIIKAVRE
KYRGDNRNPWCEIECGSYYARSMASYALLLSYSGFIYDAASGVMGFRPAGRKEKEGFSSF
WSMGSGWGTVRYEKDGSVRLVILHGSLMLKQFVYGTGENVTSVSADGEKTAFIREKDAVS
FPEEIRIEKSLELKAD

Enzyme Prediction     

No EC number prediction in MGYG000002267_00477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	451	748	2e-60	0.7272727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04685	DUF608	2.08e-48	392	748	6	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	2.30e-48	9	756	2	721	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam12215	Glyco_hydr_116N	3.62e-45	22	335	2	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam17389	Bac_rhamnosid6H	1.12e-04	458	570	104	217	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10137	PRK10137	0.003	536	584	592	641	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ98507.1	1.75e-317	7	853	1	862
ANE45793.1	9.58e-308	12	837	5	846
AEE95836.1	2.33e-301	8	848	4	869
QHT59778.1	2.17e-300	12	853	5	859
QGQ98288.1	1.31e-296	12	809	5	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DKW_A	3.27e-19	23	710	59	736	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKW_B Chain B, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKX_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKY_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
7DKS_A	1.71e-18	23	710	59	736	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKT_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKU_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKV_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
5FJS_A	2.92e-18	23	710	55	732	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	2.96e-18	23	710	58	735	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]
5BVU_A	2.97e-18	23	710	59	736	Crystalstructure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],5BX2_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with 2-deoxy-2-fluoroglucoside [Thermoanaerobacterium xylanolyticum LX-11],5BX3_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with deoxynojirimycin [Thermoanaerobacterium xylanolyticum LX-11],5BX4_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with Glucoimidazole [Thermoanaerobacterium xylanolyticum LX-11],5BX5_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with glucose [Thermoanaerobacterium xylanolyticum LX-11],5NCX_A Crystal structure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase with an covalent inhibitor [Thermoanaerobacterium xylanolyticum LX-11],5OST_A Beta-glucosidase from Thermoanaerobacterium xylolyticum GH116 in complex with Gluco-1H-imidazole [Thermoanaerobacterium xylanolyticum LX-11]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5M868	4.86e-16	2	713	124	834	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q69ZF3	5.14e-14	23	713	144	834	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q9HCG7	2.03e-13	23	711	153	841	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q7KT91	8.38e-11	10	710	106	890	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999857	0.000173	0.000004	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_00477.