CAZyme Information: MGYG000002267_01375

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_01375
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	MGYG000002267_4|CGC1	96519.16	4.8288

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 3094; End: 5634 Strand: +

Full Sequence      

MEKRKLTEWKIGKANFDFSESKQELSEKVNSITDDLLPAGQIAQVHEILIQNGLASAEVL
ESGDSSELAWVSGYDWFYKTEFTIPKEEEHYFLCCKGLDTVCDIFLNGEYLGLSESMYLP
FEKEITDLVTLDGKNSLLLYFHSHEKMLKVFTDTMPERYRGCVPARAMLLKAEDYGADPG
KCRGYWNIGIFDDVYVEGCSVLKLQEVTIDVKQSQPFQVYDKAAVSYSVRGTAYRGGMIR
ADIMVSEADGSNPLFRASGKQVEAGEFRIEGSILVENPKLWWPRNYGDQPLYRFRAELSM
DGVVCEPVCRPFGIRDIRRTGNMAFTCNGEHIRLFGGDIAPVYGPSNVFHDQTAFDLIDK
IWLAGMNAVRIWGPGKPYPDRFYDRFDELGILVWQDFPTGGSELPCDEHYRELLAGQAEA
MLRRLKHHPCIYLWCGGNENIYMNEYFERSSTIGYDILTDTFRRLCNELDPERVYHVSCP
YEGKYTNDPDFGDSHGSRAFRRFLPGEPYGVFYSENIRVYPPQYKSMKRWLGSGMWDENY
TDVRPVGCIKPMPASWASRLGNFGEEKLGPIHEYYSADTPDGLIYKFTAAASQDIYQMYA
RSRRGKPHYKSEENTICQGFMLWKINDPWPNFYCALVDYYGECAMTYYAVKRAVRPVWID
LEVDDRVYLWGVNDTLSDFRGTVTLTSFRMDENRTDRQAEIPVSLLKDTSGVLTNLDFWG
PVHWHTVLHACLKDERGEALFTTTAFLKQENMLAFPDAILTLTVEGDSVTVSTDRFARCV
ELSAGEDGEAFGWVFEDNFFDLLPFETKRVGIIRKGEGSCVRAKAQYGSTFTVCELPVVG
KGNTNA

Enzyme Prediction     

No EC number prediction in MGYG000002267_01375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	71	712	1.5e-71	0.6329787234042553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.46e-53	70	724	59	702	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.33e-10	78	483	113	476	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	3.02e-09	75	473	66	443	beta-D-glucuronidase; Provisional
pfam17753	Ig_mannosidase	1.61e-08	765	812	13	56	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.63e-07	251	315	39	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB57903.1	3.55e-140	43	833	27	807
QMW77334.1	3.55e-140	43	833	27	807
QBE99501.1	2.49e-135	43	827	27	800
QIB57902.1	3.81e-132	43	828	48	834
QMW77333.1	3.81e-132	43	828	48	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.66e-67	45	804	52	802	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	3.26e-53	33	824	22	832	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.31e-53	33	824	24	834	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.34e-53	33	824	24	834	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.43e-53	33	824	22	832	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	1.66e-50	37	827	26	851	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q5B7W2	6.38e-41	45	685	36	698	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1CGA8	6.20e-39	67	685	57	698	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4FZV0	9.31e-39	37	694	40	729	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q2TXB7	6.00e-38	70	657	60	656	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_01375.