CAZyme Information: MGYG000002267_02379

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_02379
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000002267_8|CGC3	39342.25	4.6115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 109587; End: 110606 Strand: +

Full Sequence      

MKRIEEACERAQYALWNKFWDQEKAVFVNHYPVKEEESWIYWWHAHALDALLDGYARTKE
KDYLERFKAEYDGVFRENGGTFLHNWYDDMEWMTLALIRAFDITGEKRYMEQAVSIWNDS
KTAWNDCCGGGMAWKKDQPDYKNTPANAPAAIIAFRLYQRLHREEDREWGEKILKWNLDH
LMDPDTCFIWDGMNRLGDGAVDYDWKFTYCQGVIIGAAVEYAGITNHKEYLELAGKVARQ
AVTELADEDGIFPYEGPDDCGLFRGIFFRYVYELTQVSDEFEDLKDIIKKNARMIAEKGM
NEEGLAGGDWRQKSGGTIDLAQHLSAVMTLEMAAKLGNS

Enzyme Prediction     

No EC number prediction in MGYG000002267_02379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	5	331	2.1e-81	0.9245810055865922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	3.29e-55	3	336	2	352	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	2.67e-25	41	327	34	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG1331	YyaL	2.90e-05	43	119	412	499	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97536.1	8.45e-116	9	336	10	340
AGA56980.1	1.05e-108	9	320	19	332
QTH44606.1	1.07e-107	6	339	6	345
QUL53853.1	1.93e-106	12	336	21	350
QDH23029.1	3.13e-105	12	339	384	716

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	1.58e-73	6	336	5	340	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	6.99e-70	37	336	84	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.23e-68	37	336	85	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.75e-67	37	336	85	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4D4A_A	1.17e-21	9	330	29	359	ChainA, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_02379.