CAZyme Information: MGYG000002267_02621

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_02621
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000002267_10|CGC1	42692.77	5.318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 24045; End: 25154 Strand: +

Full Sequence      

MDKIRGVNLGNWLVLEKWMHPALFEGTSAEDEDELCRQLPREELVKRLNAHRDAYITKED
FSYLSSKGINTVRIPVPHFLFGDDPAYCEPYVPCVEYLDSAFAWAEETGLSILIDVHTAP
ESQNGFDNGGICGVCKWAQDPGRVDRLLRVLEKLALRYGRHPSLWGIQLLNEPVSEPLWQ
MVRYKYLPHNPERAAGSSFVPLDVLYDFYTRGYHMLRSILPEDKKIVFHDGFRFEVWEPF
FRRAGFTNVVLDAHWYLGMGVPGEDTSELDYMRAILKEHVKKLKAMEKTVPVIVGEWCLS
HNLQPDKVYTELEKQLSYKLVGDAQLMAWEACSGYFFWSYKLVSEPEGWDFRKCVEKGWL
PGNLENGRD

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	341	4.4e-103	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.06e-24	1	361	15	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	6.78e-06	51	318	20	255	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79423.1	7.25e-132	1	363	1	369
QQR01615.1	2.60e-119	4	369	3	394
ARE65151.1	2.60e-119	4	369	3	394
QRT49144.1	4.75e-119	3	361	2	386
QJU19071.1	5.60e-119	4	368	3	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	7.63e-107	3	364	2	390	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	6.14e-106	3	364	2	390	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	6.41e-36	2	364	11	394	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
2PF0_A	1.47e-34	4	361	15	385	ChainA, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	4.91e-34	4	361	9	379	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CR35	2.44e-46	2	366	38	408	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
B8N151	5.50e-45	2	361	29	393	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	5.50e-45	2	361	29	393	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q8NKF9	3.24e-43	2	366	35	416	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
Q5B5X8	4.23e-43	2	364	27	394	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_02621.