CAZyme Information: MGYG000002267_03816

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_03816
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MGYG000002267_18|CGC3	72431.46	4.729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 68487; End: 70427 Strand: +

Full Sequence      

MEWKITETGYFELWNGPTPVLSAYSTAEHTDGRQIDTRTAQLSGTHTEADSTELVFTAGN
GLVLTERLEVTSDGIPFASCSLSEANGKSVESRRLSPLIMQAPGQGISRLWRSLWSQMLL
VPYDNTMWLRYEAVPPRAGRRSYDLTVLFSPDSREGLLIGAVDFTTWKNALVFSGFDAGK
LEARCGIAEEGTHDSVEHGSMAGNKVYSSRFCIFQGEDYRKLLEQYGDLLKTLKKPLSWN
GSVPFGFNSWAGFAFELNADNFRDTAAFMRDQLMPAGYLNEGITYANLDAGWNIIPDKIL
EEMVIQLHQNGQRAGIYDAPFAFFGQDTEAEIPGVPGHLYSEILLRNTEGELLPRVDGAI
PYDVTHPVWKEQMRWKLQRFIDWGFDYIKLDFLSHGGMEGCHFDDAIRTGRQAITEGYEF
LTENLSEDKIGRPFFISLSIAPLFPFGYGHARRFSCDAFGTAEDVEYVLNAQTYAWWQSG
RLYAANDPDHICLLKSFCMEKDSTPGEARARYTTAVIAGTVMMLSDDFRREEARQRALEF
ATNREINSLAASGSVFVPAESWGFSASNIFTAQKDGKQYAAVFHWKKGKEQVCVDLKRAG
LHPTSSFRELWSGQILHPENGILTWPVQDCDAALLEEILPEDISGI

Enzyme Prediction     

No EC number prediction in MGYG000002267_03816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	376	614	2.4e-16	0.9344978165938864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14792	GH27	3.27e-20	244	546	2	265	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14791	GH36	2.15e-10	244	538	3	289	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02692	PLN02692	8.37e-08	225	438	35	208	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK01163.1	2.83e-246	7	638	19	685
AYQ71136.1	1.48e-131	73	613	105	654
ACX66631.1	1.63e-128	118	636	152	681
QGQ94687.1	6.09e-128	117	611	142	645
QOT11183.1	1.36e-126	118	638	152	683

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_03816.