CAZyme Information: MGYG000002267_05435

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_05435
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000002267_39|CGC1	86768.6	5.8016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 18131; End: 20443 Strand: +

Full Sequence      

MDFPQQFISASQEYADYGHPVPAPYIRKKFTLLAEPQSAELLITGLGFYRVFLNGTELTK
SILAPYISNPDDIIYYDRYDALPYLAKGENCIGVILGNGMQNAYGGFVWDFDKARWRSAP
MTTLRMDMELAGGGRVSIESDTSFLTHPSPLLEEELRSGECYDARLRIDDWCSPSSPEDG
WRPVVKVTPPRGSMRLCKASPIRIYEKRRAVSILPYEEGYLYDFGIDAAGVCELKISGRR
GQKVQISYAEWYHDGVLEKKNLMFPEYPSPHTANVQNSCYVCRGDKEESYMPFFTYYGFR
YAYVTGIEKEQAVPELLVFHVCGGDFRENGNFSCSDEIANELQIMTRRASISNFFWFPTD
CPHREKNGWTGDAALSAEHMLMNLTVEDSLREWLHSIEEAQSPAGEFPGIVPTGGWGVGT
GPAWDQIIAEIPFCLLKLRGDLDTAKEAAPFLFRYLFFLSGIRNERGLVDTGLGDWCETG
KSGGGQKAPIEVTDTAVCVHLLEEAKILFRRLHREPEYRYAAALRHELKKAFRKYLIDFN
TMTVAGSCQTSQAMAIHYGLFQKAERPLAFSRLLEMIHQNGDHMNAGALGLRILFHVLSD
YGQADLAFHMITRKDYPSYGNWIARGATSLWEDFLPPEAEVHSQNHHFFGDISSWFIQAV
AGIRPNPYLEDADYIVVAPHFIQTLTYAEAFYKAPSGSITVRWERTDGITDNAPGKKITL
TIQTTGSLIGTICLPGGWEFADGFCEKQLHPGIYTCKCKACCPALQTRKY

Enzyme Prediction     

No EC number prediction in MGYG000002267_05435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	219	708	8e-112	0.9484126984126984
CBM67	15	191	1.8e-24	0.9147727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.73e-76	327	660	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.72e-40	34	206	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.87e-13	220	310	8	90	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.95e-04	674	709	11	46	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	3.02e-143	14	704	124	818
AHF16194.1	1.84e-128	23	736	172	863
AYB33152.1	5.57e-128	22	708	183	858
QNN24933.1	7.37e-125	2	735	331	1055
ANH83620.1	1.12e-120	19	742	136	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.44e-86	23	728	176	896	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.70e-66	3	708	278	976	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.21e-58	27	742	135	855	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.15e-73	23	723	184	895	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	3.35e-65	3	708	278	976	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.63e-64	25	704	176	856	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.86e-64	25	706	172	858	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_05435.