CAZyme Information: MGYG000002268_00586

Basic Information

• Species: Clostridium_AQ sp003481775
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp003481775
• CAZyme ID: MGYG000002268_00586
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000002268_2|CGC4	56122.92	7.3981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002268	4827062	Isolate	China	Asia

• Gene Location: Start: 265509; End: 266969 Strand: -

Full Sequence      

MNKDFLWGGATAANQYEGGYNKGGRGPNTFDCMGSGSFKNIRRISCKVDNKIVWIPRNSS
LPNGAKGCIADGAYYPSHQATDFYNHYKEDIALFAELGFKCYRMSISWTRIFPKGDEEKP
NEEGLLFYKNVFKELLKYNIEPIVTLNHFDMPLYLANSIEGWKSRKTIEYFEKYCKTVIK
KYASYVKYWITFNEINFMFSWHTLGISSMDEQTRYQALHHVFIASARVVQWCHANYPQKK
IGMMFSMPISYPEDCNPKNVLKTYQEMNNEFFFSDVQCRGYYPKYKLNEFIRKGIVINKE
NTDDTDLKKGVVDFISISYYHSGVVTIRENAETTGGNLIQLVKNPYLDASEWGWQIDPLG
LRIALNQIYDRYQKPIFIVENGLGAVDEVVDIDGVKTVEDDYRIYYFKEHLKSLMDAIEY
DGIDVIGYTAWGCIDIVSGGTGEMKKRYGFIHVDMDDHGAGSLKRTKKKSFDWYKAVIAS
NGECIR

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	482	1.1e-138	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	3	483	6	474	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	485	6	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	3	483	8	475	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	483	4	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	485	8	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLY82089.1	5.59e-210	1	483	3	484
QNM13495.1	8.65e-206	1	485	2	485
BCA85379.1	3.95e-202	1	483	3	483
QUN12776.1	2.81e-200	3	483	5	485
QCT93018.1	2.06e-199	3	483	5	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	5.23e-170	1	483	8	477	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	6.89e-163	5	485	12	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	9.85e-158	1	485	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.80e-157	1	485	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.56e-151	1	485	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	2.86e-169	1	483	8	477	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.51e-161	1	483	4	477	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	2.00e-159	5	485	12	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	7.73e-158	3	483	6	471	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	1.72e-156	3	485	9	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002268_00586.