CAZyme Information: MGYG000002268_01644

Basic Information

• Species: Clostridium_AQ sp003481775
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp003481775
• CAZyme ID: MGYG000002268_01644
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	MGYG000002268_9|CGC1	54012.15	5.6196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002268	4827062	Isolate	China	Asia

• Gene Location: Start: 87318; End: 88724 Strand: -

Full Sequence      

MSRFPNGFLWGGAISASQSEGAYDVGGKGLTIFDVTEAGNKNTPRKRHDKIENDIHYPSH
TAIDFYHTYAQDIQLFRELGIQCLRTSINWTRIYPNGIEELPNEEGLAYYDALFDELLKN
DITPVVTIHHSDTPLYIAEHYGGWINRTTVDLFLKYAKTVLCRYKDKIKYWIVINEINAI
NYVEWFSAAAENMTLQEKETASYHLLLANASVVCAAKKINPDFIMGGMVTDCHTYPYTCD
PQDVFQSIQDKHRNIFFADVMCRGEYPSYKWKELNRFDIQLHIKEEEKNILKKGCIEFLA
FSYYSSHVSSMVKDEDIQGNLIQNIKGKNNPYLKSSQWGWSIDPMGLRIALNEFYDRYEL
PLFIVENGLGARDDAKQLPYINDDYRIEYLREHIAAARDAVTIDGVDLMGYLVWGFIDIV
SGVTGEMDKRYGLIYVDRNNKGQGSNLRYKKKSFEWYQKVIASQGEEL

Enzyme Prediction     

No EC number prediction in MGYG000002268_01644.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	465	4.4e-131	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	468	1	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	1	467	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	1.19e-176	1	468	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	6.81e-176	4	468	6	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.01e-163	4	468	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGD88872.1	4.56e-174	8	468	7	474
QAV30572.1	6.94e-172	1	468	1	479
AGZ25415.1	6.94e-172	1	468	1	479
QJX55105.1	6.94e-172	1	468	1	479
QKI07663.1	1.39e-171	1	468	1	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	5.07e-158	3	468	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	2.14e-154	5	468	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	2.39e-150	1	468	17	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	1.58e-149	4	468	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	4.01e-147	1	468	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	1.83e-165	1	468	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	2.99e-159	3	468	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	1.17e-153	5	468	9	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	7.01e-146	4	468	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	4.13e-145	1	468	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002268_01644.