CAZyme Information: MGYG000002268_04276

Basic Information

• Species: Clostridium_AQ sp003481775
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp003481775
• CAZyme ID: MGYG000002268_04276
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000002268_70|CGC1	54549.54	5.0093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002268	4827062	Isolate	China	Asia

• Gene Location: Start: 4343; End: 5767 Strand: -

Full Sequence      

MILDEHFLWGGGTAASQFEGGFHEGGKGLNNMDVVTDGSKDRLRKITDVVEPNKFYPSHT
GIDFYHMYKEDIRLFAEMGLKSFRMSIDWTRIYPTGAEIEPNQEGLSFYHNVIDELLKYD
IIPLVTIKHLEMPLKIAQNGAWTNPDTIHMYVKYAKTLFHEFKGKVKYWLTFNEVNHAVW
YDNDNADVYSYFGTGLKFNEIENPDNALANAMYNVLKASALAVIAGHDIDEANQIGCVHA
FVPQYPATSKPEDSLATLQAYDQDCFLLDVMIKGYMPDYKIREYEKENIEVTKEDKEIFK
KGTIDFFGLNYYSSGMSAAENRGYGNAFFHGYKNPELPINEWGWENDPVGLRFALNYLNR
RYNIPIMITENGLGASDILENETVNDDYRIAFLKDHIEQMEKAIWEDSVNVLGYYVWSPI
DIVSASTGEMSKRYGLIYVDIDDKGKGSRKRFKKKSFDWYKQVIASHGEDLHIR

Enzyme Prediction     

No EC number prediction in MGYG000002268_04276.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	468	3.2e-135	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	9.15e-180	5	473	6	459	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	5.49e-171	1	471	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	1.27e-161	1	471	4	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	4.44e-159	1	471	4	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09852	PRK09852	1.60e-158	5	471	6	473	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASU19955.1	1.32e-172	1	471	1	475
ANU67614.1	1.32e-172	1	471	1	475
QQR24573.1	1.32e-172	1	471	1	475
QNM13263.1	3.04e-171	1	471	1	475
SET74866.1	4.46e-171	1	471	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	7.98e-151	1	471	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	7.89e-146	5	471	10	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	6.46e-145	3	471	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.83e-144	3	471	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	7.98e-141	5	471	13	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	6.70e-152	3	471	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	4.37e-150	1	471	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	1.88e-146	5	471	10	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	2.57e-137	2	471	3	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	2.00e-136	1	471	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000035	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002268_04276.