CAZyme Information: MGYG000002270_00115

Basic Information

• Species: Enterococcus_A avium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A avium
• CAZyme ID: MGYG000002270_00115
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000002270_1|CGC1	56315.55	5.0569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002270	4464845	Isolate	China	Asia

• Gene Location: Start: 111429; End: 112847 Strand: +

Full Sequence      

MEISIPKDFIIGAAASAWQTEGWKGKKEGQDSFIDSWYKNERFVWHEGYGPAVATNFMEN
YEKDIALMKEIHLTHYRTSINWARFFTDYEKLIVDEEYAAHIDGIIDRQIEAGVEPMICL
EHYEVPSYLLDTYDGWSSKHVLELYVQYAQIAFERYGDRVKNWFTFNEPIVVQTRCYLDA
ARWPHEQNTKKWMLWNYHKALATARVVESYHRTQDDGRIGCILNPEMVYPRSSSVEDVQA
AKMYDLFFNRVFFDPMINGEYSEELIQVCKKHEIYFDPTNEELEVIKNNPVDFLGINQYY
PKRVRAPRYAWSDQTPFHPEAYYESFDLPGRRMNNSRGWEIYPEIMYDMSMYLKDNYRPI
PWLITENGMGREQEELYKNEDGIVQDDYRIEFISQHLYHLLRGVKDGSTCEGYMLWAFTD
CVSPMNAFKNRYGLVRIELDKQRTRSLKKSAYWYRSLVDDRKLIVEDEKDFK

Enzyme Prediction     

No EC number prediction in MGYG000002270_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	460	1.5e-116	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	4.22e-141	6	459	5	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	5.26e-98	1	458	1	448	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.84e-74	1	464	1	469	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	6.24e-55	5	458	4	469	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.27e-52	2	458	3	470	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ12189.1	0.0	1	472	1	472
AYQ25046.1	0.0	1	472	1	472
AWX46690.1	4.47e-288	1	468	1	468
QZY26560.1	6.35e-288	1	468	1	468
QOG26747.1	1.89e-287	1	467	1	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	2.62e-127	3	464	1	462	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	1.53e-126	3	464	2	463	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAQ_A	6.48e-122	3	457	18	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAV_A	9.17e-122	3	457	18	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	1.92e-81	3	466	9	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	3.35e-124	6	459	10	461	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	2.07e-63	2	458	3	443	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
B3W7I3	5.73e-62	1	459	1	468	6-phospho-beta-galactosidase OS=Lacticaseibacillus casei (strain BL23) OX=543734 GN=lacG PE=3 SV=1
P14696	8.02e-62	1	459	1	468	6-phospho-beta-galactosidase OS=Lactobacillus casei OX=1582 GN=lacG PE=3 SV=1
P10482	1.97e-61	1	460	1	453	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002270_00115.