CAZyme Information: MGYG000002270_02698

Basic Information

• Species: Enterococcus_A avium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A avium
• CAZyme ID: MGYG000002270_02698
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000002270_27|CGC1	56224.63	5.0762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002270	4464845	Isolate	China	Asia

• Gene Location: Start: 17303; End: 18763 Strand: +

Full Sequence      

MKWTQAARYRPYQEWSEEYVKDLKRKVTASKWRLNYHVQPETGLLNDPNGFSYSNGKWHL
FYQSFPFGAIHGLKSWFHITSKDLVHWEVEGPALEPDSVYDSHGVYSGSAIPVEEKLFLA
YTGNVRDETWERHSYQLGAWMNNNGTVTKLEMPLISAPPIGYTAHFRDPQIVPYEDEYLM
VIGGQTSDEKGNILIYRSQNLIDWTYRGPLALNQDLGFMVECPNLLFIDGKLVILLCPQG
MGKSVLEYQNVYPNTYILAEDYIIEENRLEHPLQQQLLDEGFDLYATQAFNAPDGRCLSV
GWIGLPEMDYPTFNEGWAHSLSLIKELTLKKGKLYQYPVAETKQLRKTKETFILEPTEQL
RKTTNNCYELQLIIPKNSHGEIHLFSDKTDMYALILSYDTEEGKLQLDRRNTHYPLNPEF
GEIRESLVAPSEAMRLSIFVDQSTCEIFINHGERVLTANYYPEENQKELVVKGTKNISIT
YYSLEK

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	338	5.1e-84	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	0.0	20	462	1	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.01e-166	5	472	1	469	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18623	GH32_ScrB-like	1.58e-148	43	331	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	1.48e-127	37	452	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	2.37e-124	37	338	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXG40102.1	2.05e-247	1	486	1	486
BAK93626.1	8.41e-197	2	474	6	482
QXN87096.1	3.40e-196	2	474	6	482
QCJ57477.1	1.64e-195	2	486	6	489
BBM14440.1	1.64e-195	2	486	6	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	6.89e-142	1	475	1	477	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	3.67e-64	17	486	34	484	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	5.39e-63	17	486	34	484	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
7VCO_A	2.65e-56	36	469	29	466	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
1UYP_A	4.54e-50	35	485	5	428	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43471	1.18e-158	1	473	1	473	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
P13522	1.90e-149	1	485	1	478	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3
Q04937	7.23e-140	1	486	1	473	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
Q05936	1.56e-113	2	485	3	490	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	4.45e-101	2	473	6	464	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999931	0.000105	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002270_02698.