CAZyme Information: MGYG000002270_03959

Basic Information

• Species: Enterococcus_A avium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A avium
• CAZyme ID: MGYG000002270_03959
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		42020.38	9.2338

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002270	4464845	Isolate	China	Asia

• Gene Location: Start: 18488; End: 19606 Strand: -

Full Sequence      

MRRRPAIMWSLLALLFWGYIAMVLFNINDNQKKLEKSAYQQWHSTYVKKSSVGTFVKTNP
KEEIDISLSEGHGYGMLITMEAVKRGWASEKDFNELYQYYKNFQISKDNPLMSWQQTYEA
NKPIKKEATNATDGDLDIAYALIEASKQWPNSQTNYKAAAQKLLSGIKARNYNSTNKLLT
VGDWATKDSDSYNLIRPSDIVPSYFDTFAAFSGDDFWRTLKKNSVKALENLSNQHKTGLL
PDFAWVEKDTVTPAKKNQIAGANDGNYGANACRIPWRLASSNDKDVNQVLSKMMNFFLEK
NTINEGYTLSGKALSSNQSKSFSAPILYAANQKEAYGNLMNSQGWVITDGLSGEDYYGDT
LTTLITLQMNPK

Enzyme Prediction     

No EC number prediction in MGYG000002270_03959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	37	367	2.9e-75	0.9875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.33e-28	38	367	7	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	4.81e-14	59	315	45	294	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.19e-06	128	364	111	346	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ14860.1	1.48e-270	1	372	1	372
AYQ25485.1	3.34e-267	1	372	1	372
QXJ59064.1	2.60e-209	1	372	1	372
QZO08783.1	5.25e-209	1	372	1	372
BBM16590.1	1.91e-202	1	372	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	4.52e-52	36	370	63	403	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	6.32e-34	36	367	32	375	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	7.49e-34	36	367	38	381	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1CEM_A	5.50e-22	26	358	15	338	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	1.23e-20	26	358	15	338	ChainA, Endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.77e-51	36	370	63	403	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	6.51e-30	36	367	88	431	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37699	5.26e-23	34	367	62	383	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2
P37701	2.43e-22	24	367	52	383	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
A3DC29	6.26e-20	26	358	47	370	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994995	0.002786	0.000952	0.000020	0.000010	0.001267

TMHMM  Annotations     

start	end
5	27