CAZyme Information: MGYG000002271_01064

Basic Information

• Species: GCA-900066135 sp900066135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066135; GCA-900066135 sp900066135
• CAZyme ID: MGYG000002271_01064
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
871	MGYG000002271_3|CGC1	99753.36	5.0763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002271	3727782	Isolate	China	Asia

• Gene Location: Start: 228568; End: 231183 Strand: -

Full Sequence      

MRPIDIKIQNTAVREGIVEAPVICWKFSERDAGKRQAACRILLKRPDGGCLYDTGTLETG
KQNGHQLELSFQTHIRFFAEVEITDTEGKTESGRSEIYVSGIAPEKTPEKNWIGNGTGDP
FYALRFLEPGKKLKNAYCSAAATGQYELRINGKLPDDSVLNGSWTDFHKRIHYRTFEVTA
LLKEGRNCLSMEAGNGWYYGKCKDGRYFYTMDKGYEAFGDKLGVNVFLTLEYEDGTREEV
VTDESWRILESPVTYTNIYGSEDFDSRKENTYWLFSPEEEEKLAKAVFLEDGPKLGKLEP
ALYAPLKVIRAYEGKTVAVEPDGSLVYDLGQNMAFLFELRVKGTCGQKLRLQCAENWKAG
EPFHPMTNSWCEEILSGGTECFEPKFTYLAGRYVKVGFLDQTGEKRPEIQYLRGCQISSS
VERTGEFRCSDGRYDEIRNLIENSIRNNLQHVHTDCPTAERLGWQEPNHLMAPSIMYTYD
VEPFWEKIEWDQCDSQYPKGEKDVDHGAFPHTYAAGLLPSIAPRYARFLVDGGDGSFWDI
IPWGSSLVMGLKERERFYGEKKDAGDFYEFIRKYTDYQYEKYLSYASVYGKKEGVCFLRQ
GLGDWGTWRKEDNSRENIETAYLYRNLVLTAELAGRTGRKTDQKKYEILAEDCKEQYNHL
LLKKHPVTGEWYYQSWESDDDEIIQGNQAVPLQFGMAPEDKKASIEKSFLESVKEHRFLA
GEIALPYIFRTLGELGEMDIVHDMILQKEHPSYYRFVEKGETCLPEFWSDEARSRDHDMM
GSILEWFYRYVAGISSEDGYSSIRIEPRLPKALDWAECRYQSLTGLVEVSVRRKEGGRLE
VSCRIPANTVGTLEVNGKAVVLTGGITCRVS

Enzyme Prediction     

No EC number prediction in MGYG000002271_01064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	320	854	1.1e-104	0.9900793650793651
CBM67	131	273	1.5e-18	0.7102272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.34e-62	422	791	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.56e-39	131	310	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.30e-09	321	418	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.67e-08	793	865	1	73	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL25376.1	4.02e-151	111	841	6	738
AIQ51389.1	1.45e-145	1	855	2	839
QBE95492.1	1.07e-144	110	833	6	734
BCS07621.1	1.83e-110	112	855	153	879
BCR95051.1	1.83e-110	112	855	153	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.84e-84	3	855	32	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	9.56e-59	126	849	309	988	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.54e-49	135	858	142	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	7.74e-63	19	856	49	907	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.35e-58	120	855	174	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	4.90e-58	126	849	309	988	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.75e-41	120	848	170	871	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002271_01064.