CAZyme Information: MGYG000002271_02611

Basic Information

• Species: GCA-900066135 sp900066135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066135; GCA-900066135 sp900066135
• CAZyme ID: MGYG000002271_02611
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732	MGYG000002271_14|CGC1	83744.97	5.3229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002271	3727782	Isolate	China	Asia

• Gene Location: Start: 20259; End: 22457 Strand: -

Full Sequence      

MSTYKKADLSGAEWISTGGACMTPMIRKTMVFPKVKSAKITIAGLGIFEAFINGKRVSED
LFLPLSTDFHERPEKLYRGVPYGEKMRHRLYCPVYDITSYLKEGDNTIAFLMGPGWYEMP
NECYEYGHIKLCYVIDYQDEKGEEHRTGSDGSHRWKESYVKKANLLKGEVHDYRDYDESW
MENAFDDSGWQPVSPEKEPETRLYIQDCPADRVIRHITPKLLAEKGDVRIYDAGEIFTGY
PVLVSDAPAGEEITVVHGELLNKKGRLAKENTYKQKTVFYTDGTERRMHCRFTWFGFQYF
EVKGNARVVDCVVIHSDVKVDSTFSCSDETLNWLREAYLRTQLDNMHCGIPSDCPHVERR
GYTGDGQLTCNAAMIQLDGEKFYRKWIQDIADCQDSITGHVQYTAPYIPSGGGPGGWGCA
IVMVPYVFYRNYGDETILKELYPQMLHYLDYLENHSEKDLVVSDRAGEWCLGDWCVPTMG
FVNNMDAIYIPAPLVNTYFYIRSMEKVLEIGEIIGEHQADEAIREKIRRKKQAIQDTYFD
PETGDFAGNQQGSNVFAVDLGIGDERTFANVIRHYREIKKYDTGIFATDVLTRILFERGE
SELAVSLLTSKEDDTFYSRMKMGGTTIPEYWTGHRSQCHPMFGAVSQYLFAYVLGIRQKE
HSICYEDLVIAPECMDSIEEAEGSIMTKNGRISVKYNKTEITVRIPEKTKALLLMNGQEQ
VLEAGKETVVKR

Enzyme Prediction     

No EC number prediction in MGYG000002271_02611.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	227	713	3e-116	0.9821428571428571
CBM67	13	194	4e-20	0.9318181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.10e-69	322	653	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.83e-35	34	215	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	8.70e-10	225	306	4	88	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.003	669	729	13	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	6.80e-188	12	698	6	687
BCJ98018.1	1.15e-120	14	725	127	870
QMW80401.1	5.79e-109	12	730	125	848
QIB56822.1	5.79e-109	12	730	125	848
QBE96295.1	7.91e-109	1	730	114	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.90e-68	4	700	157	879	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	8.16e-53	34	711	315	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.36e-41	37	718	146	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.14e-62	34	719	196	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	4.30e-52	34	711	315	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.04e-45	35	711	187	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.53e-38	23	706	169	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002271_02611.