CAZyme Information: MGYG000002273_00011

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_00011
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812	MGYG000002273_1|CGC1	90189.12	5.8588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 12822; End: 15260 Strand: +

Full Sequence      

MKLTNIIFVLLVFFPFYAKGKETAKLVKDKKTNILFYDLNKNGKMDIYENPTLDIESRVE
DILSQMTLEEKVGQMLTSLGWHMYERVGDDVRLTKRLTEELDKYHIGSLWGFMRADPWTQ
RTLKTGLNPTLAPKAVNKLQRYVIENTRLGIPLFLAEECPHGHMAIGTTVFPTSIGQSST
WNLKLIEQMGRAIAKEARAQGAHIGYGPVLDLARDPRWSRVEETYGEDPFLIGKMGEALV
RGFQGDDFNPGESLLSTLKHFASYGWTEGGHNGASAHVGMREMEEAILPPFREAINAGAL
SVMSSYNEIDGIPSTANYHLLTKVLRNRWGFQGFTISDLRSIGRLREHGVAASDYEAAVK
AVNAGLDNDLGMNVYGDQLGEAVKKGDVSTAVLDQSVSRILRLKFRMGLFDNPFVDEKAA
PEMVANSEHLELAREVARQSIVLLKNRNNILPLKKNCSKKIAVIGPNADNIYNMLGDYTA
PQTTASVVTVLEGIKNKVDNEDVIYAKGCAIRDTSRIGIRDALNAAASADVVIMVMGGSS
ARDFSSEYEETGAAKVSANLISDMESGEGYDRATLNLMGLQLELIQEIKKLGKPIILVLI
KGRPLLLEGIIQEVDAIIDAWYPGMQGGNALADVLFGDYNPGGRLSISIPRSVGQLPVYY
NPKRTGNRNKYLEEVGVPRYCFGYGLSYTSFEYSDMEVTLNETTDDCTVNIRVKIVNAGQ
KSGDEVVQLYICDDVSSYTTPAKQLRAFERIHLEAGESQIVTFTLNKKSMMLYMQDDEWV
VEPGSFSLMIGSSSQDIRLQHKIYVTQKYCLK

Enzyme Prediction     

No EC number prediction in MGYG000002273_00011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	145	368	2.8e-70	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	59	801	38	761	beta-glucosidase BglX.
PLN03080	PLN03080	7.38e-103	148	805	78	777	Probable beta-xylosidase; Provisional
COG1472	BglX	1.93e-102	66	511	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.85e-82	67	403	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	7.97e-72	441	688	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANQ59509.1	0.0	1	812	1	813
AKA50871.1	0.0	1	812	1	813
CBW21397.1	0.0	1	812	1	813
QCQ40510.1	0.0	1	812	1	813
QCT77360.1	0.0	1	812	1	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.87e-148	134	798	106	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	2.39e-145	54	798	9	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.32e-144	54	798	9	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	1.52e-144	48	805	7	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.18e-143	48	805	7	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	4.13e-148	46	798	22	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	8.18e-148	46	798	22	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	7.08e-140	146	795	60	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.94e-134	48	798	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.50e-97	55	797	35	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999108	0.000174	0.000143	0.000141	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_00011.