CAZyme Information: MGYG000002273_01161

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_01161
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000002273_5|CGC3	42799.35	8.7932

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 175497; End: 176651 Strand: -

Full Sequence      

MKKWLLACLAAACIESNVQAQQADETLKLWYDKPADQWVEALPLGNGRIGAMVFGDPAHE
QFQLNEETVWGGSPYNNTNPKAKDALPRIRQLIFEGKNAEAQALCGPTICSQSANGMPYQ
TVGTLHLDFDGISNYNDYYRDLDIEKAVTTTRFTANGVTYTREAYTSFPDQILVIRLIAS
QKKSISFTAKYTTPYKENVVRCISPRKELQLNGKANNHEGIEGKVEFTALTRIENSGGKL
EVLSDSTLQVKNANSVTLYVSIGTNFVNYKDVSGNAQATAQKYLANVNKNYTKSKATHIN
TYQKFFNRVSLDLGRNAQANKPTDVRVKEFSSSFDPQMAALYFQFGRYLLICSSQPGGQA
ANLQGIWNYQLRAPWMVNTLLIST

Enzyme Prediction     

No EC number prediction in MGYG000002273_01161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	23	377	5.4e-113	0.47368421052631576

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	5.96e-89	29	268	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61277.1	1.37e-241	1	375	1	375
QUT93139.1	2.75e-241	1	375	1	375
QDO69192.1	8.91e-241	1	375	2	376
QUT77816.1	1.03e-206	1	375	1	372
AII65975.1	1.02e-126	23	375	23	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	2.70e-89	25	375	20	365	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	7.90e-85	16	375	19	386	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	2.66e-62	26	381	2	371	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAE_A	2.66e-34	29	368	19	401	ChainA, Alpha-fucosidase [Bifidobacterium bifidum]
2EAB_A	2.67e-34	29	368	20	402	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	1.16e-55	18	375	43	426	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	8.92e-37	29	375	23	382	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q2USL3	4.49e-26	29	375	18	379	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2
Q5AU81	6.54e-26	44	375	46	402	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000705	0.874769	0.123569	0.000332	0.000319	0.000276

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_01161.