CAZyme Information: MGYG000002273_01167

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_01167
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		23855.81	7.4414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 180907; End: 181536 Strand: -

Full Sequence      

MICPSSTEDENGWRIHFEISDDAGKTWRKTGPIPAAEIIETDKVKISNRNHRTIQVIQPT
ILVHADGRLQALCRTQNNGSVATTWSKDNGETWSEVTFIDLPNNNSGIDGVTLKDGRHLL
VYNHYRYIKGKRKERTPINAAISDDGIHWKAAVILEDSPINQYSYPSVIQGKDGNVHIVY
TWRRQRIKYVCLNPQQLEISSFEEVGWKE

Enzyme Prediction     

No EC number prediction in MGYG000002273_01167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	2	180	3.7e-23	0.4619883040935672

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	1.30e-63	1	178	124	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	4.19e-34	6	193	165	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	1.64e-19	4	194	167	373	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	1.25e-07	20	179	52	215	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61281.1	2.71e-130	1	209	1081	1289
QUT93135.1	1.03e-129	1	209	1081	1289
QUT77833.1	6.98e-76	1	197	1053	1267
ACT93371.1	5.65e-75	1	207	168	359
ALK84931.1	6.96e-75	1	198	990	1201

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_01167.