CAZyme Information: MGYG000002273_01169

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_01169
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		58109.17	5.6994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 184754; End: 186358 Strand: -

Full Sequence      

MNTFIKRLLVLTALTLPLLPVQNVVNAQNGDYIDDSIYENLPFDMPKVEQPTFPDYTVSI
VDFGAKGDGIVLNTKAINDAIKAVNAKGGGKVVIPEGLWLTGPIELLSNVNLYTETNALV
LFTDDFEAYPIIKTSFEGLDTRRCQSPISAWNAENIAITGQGVFDGSGDSWRPVKKGKLT
SGQWSSLVNSGGVVDESGSIWYPTAGALKGAMATKDFNNPEGINTDEEWNEIRPWLRPVL
LNIVKSKKVLLEGVTFKNSPSWCLHPLSCEHITIHNVKVFNPWYSQNGDALDLESCKNAL
IVNNIFDAGDDAICIKSGKDKDGRRRGEPCQNVIVKNNTVLHGHGGFVVGSEMSGGVKNV
YVTDCTFLGTDVGLRFKSTRGRGGVVEGIYIHNINMIDIPHEALLFDLFYGGKAAGEETE
ADLAGRMKSSVPPVTEETPAFRDIHITNVTCKGAGRAMFFNGLPEMPIRNVHVKDVVITD
AKEGIVISQAENVSIENVKVETKGKALQVKQAKDLKVNGKTYNNSAAKALNIDL

Enzyme Prediction     

No EC number prediction in MGYG000002273_01169.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	84	500	5.7e-85	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	5.85e-86	51	470	76	468	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	3.66e-19	156	410	26	250	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	1.44e-16	21	482	28	412	polygalacturonase ADPG
PLN03003	PLN03003	2.38e-15	58	436	24	321	Probable polygalacturonase At3g15720
PLN03010	PLN03010	8.08e-13	241	399	160	310	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT93134.1	0.0	1	534	1	534
ALJ61282.1	0.0	1	534	1	534
QDO69196.1	0.0	1	534	1	534
AVM53658.1	0.0	1	532	1	530
AVM57477.1	0.0	1	532	1	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	4.96e-74	48	507	18	446	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	1.74e-71	42	498	29	446	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	2.13e-29	58	415	157	506	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	6.20e-16	75	413	31	317	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	1.93e-12	55	182	21	137	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.18e-41	56	396	61	358	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	2.62e-32	58	410	152	494	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P27644	4.28e-30	241	467	25	249	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P18192	1.22e-17	82	413	57	343	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
Q8RY29	6.54e-17	57	405	67	351	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999078	0.000177	0.000172	0.000157	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_01169.