CAZyme Information: MGYG000002273_02936

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_02936
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279	MGYG000002273_19|CGC2	31119.31	4.5695

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 33687; End: 34526 Strand: -

Full Sequence      

MMNIWKGILAAFMLAAVFGCGMGTSKKNGSGEVAEQLPRLCVTGTQLMNEKGDTVVLKGV
SYGWHQFWPRFYNASTVAYLSEDWGAQVLRASMGIELDTAYLERPQMGIDCVQKVVDAAI
ENDVYVIIDWHSHGIRQEEAKDFFAKMATRYKGVPNVIYEIFNEPVDDSWEQVKAYSVEV
IKTIRAIEPEAVILVGCPHWDQDIHLAADDPITGYDNIMYTVHFYANTHGQWLRDRTDYA
LGKGLPIFVSECAGMEASGDGAINKEEWQTGWTGCSGVP

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	270	1.8e-90	0.9324894514767933

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.19e-50	48	259	1	243	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.99e-07	112	228	118	278	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59275.1	2.87e-173	2	269	1	269
QUT89667.1	6.74e-172	2	269	1	269
QBJ17986.1	1.18e-158	1	268	1	266
QMI79433.1	1.18e-158	1	268	1	266
QUU00598.1	1.51e-158	1	268	1	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1A3H_A	1.07e-59	33	269	2	243	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	1.16e-59	33	269	5	246	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]
1H5V_A	1.20e-59	33	269	5	246	Thiopentasaccharidecomplex of the endoglucanase Cel5A from Bacillus agaradharens at 1.1 A resolution in the tetragonal crystal form [Salipaludibacillus agaradhaerens]
1E5J_A	1.23e-59	33	269	5	246	EndoglucanaseCel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Methyl-4ii-S-Alpha-Cellobiosyl-4ii-Thio Beta-Cellobioside [Salipaludibacillus agaradhaerens],1QHZ_A Native Tetragonal Structure Of The Endoglucanase Cel5a From Bacillus Agaradhaerens [Salipaludibacillus agaradhaerens],1QI0_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Cellobiose [Salipaludibacillus agaradhaerens],1QI2_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With 2',4'-Dinitrophenyl 2-Deoxy-2-Fluoro-B- D-Cellotrioside [Salipaludibacillus agaradhaerens],2V38_A Family 5 endoglucanase Cel5A from Bacillus agaradhaerens in complex with cellobio-derived noeuromycin [Salipaludibacillus agaradhaerens]
6GJF_A	3.28e-59	39	269	12	246	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O85465	2.46e-60	1	269	1	272	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	2.40e-59	1	269	1	272	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P07103	1.20e-56	12	267	24	279	Endoglucanase Z OS=Dickeya dadantii (strain 3937) OX=198628 GN=celZ PE=1 SV=2
P10475	2.13e-56	39	268	41	277	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	5.86e-56	39	268	41	277	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_02936.