CAZyme Information: MGYG000002273_03096

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_03096
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000002273_21|CGC1	45477.26	5.4954

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 4829; End: 6031 Strand: +

Full Sequence      

MMNSKQALFSLLICVLAITGCDTQKQALVGNELALTRAKQTLDSLYQNYSVSGTCLLREN
YPSNIGDYTATYLASEEQKNMPNLYSYLWPYSGTFSAVNALFETTSDANYKSLLDNKVLV
GLEEYFDTRRTPEAYASYINSAAQSDRFYDDNVWLGIDFTDVYTLTKEAKYLQKAQLIWN
FIESGMDSNLGGGIYWCEQKKESKNTCSNAPGSVLALKLFKATKDSTYFVKGQHLYEWTK
ANLQDSTDYLYFDNIALDGKIGKAKFAYNSGQMMQSAALLYQLTGDKNYLTDAQNIARAC
HNYFFMDYATEQGKTIKLLKKGDIWFTAVMLRGFIELYQADRNKAYLDSFNQSLDYAWEH
ARDEKGLFSTDLSGNTHDNRKWLLTQAAMVEMYARLAAVK

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	72	381	4e-70	0.835195530726257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	2.84e-32	60	305	21	256	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.34e-09	145	271	88	212	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
PTZ00294	PTZ00294	0.010	279	324	170	210	glycerol kinase-like protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59939.1	3.38e-258	2	400	1	399
QUT89047.1	1.38e-257	2	400	1	399
QDO71507.1	5.78e-243	2	400	1	399
QGT72765.1	1.30e-239	2	400	1	399
CAH09003.1	2.79e-227	2	400	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.57e-102	38	396	8	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	5.99e-69	88	400	45	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	2.97e-68	88	397	169	492	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4V1S_A	4.83e-28	3	400	6	391	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	1.92e-25	3	368	6	357	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36091	2.33e-07	168	304	141	287	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
Q5ACZ2	2.25e-06	163	305	136	291	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000014	1.000027	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_03096.