CAZyme Information: MGYG000002273_03552

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_03552
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	MGYG000002273_27|CGC1	49533.69	4.2805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 10843; End: 12189 Strand: -

Full Sequence      

MKIRTILLTGGLVLLAACSESKYDIDQLVPEEYHKILYVNNSGKQEVTLYDTDADNLYTL
SVIKSGSDPSLTAAANILVLTQAELDVKYSEPEAVNYQLIGADAYSLAASSVDFSSADRY
KLVTISLKPQVVKAAIESNPDAVWVLPLKVTSETDSINAEKNELFLQLKAVITPAVGFTD
PTLVVQQYQYGSVSTITQKVKFGLDTDNLWDLTAKLVVDNDYVQEYNWDNGTNYKTLPEG
SYTVPETAVLPSGTTTLELEVSVNGSQLTPGDYMLPVKVAEVSQFEISEARAVYPLAIRI
MGNKLDRTGWTAEADTEELTGEGAGNGVAGCVLDDNLGTFWHSTWQTGNRIPLPYELIID
TKKEYTFTQLALMQRQHDSNRDTKAGEFYISSDKENWTKVGSFNMQQILEAQTFGVTPTK
GRYVKIKMTESFRDGYCSLTEVYAYGLE

Enzyme Prediction     

No EC number prediction in MGYG000002273_03552.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	315	442	1.8e-16	0.9435483870967742

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08522	DUF1735	2.62e-16	182	286	15	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00754	F5_F8_type_C	9.12e-14	320	442	5	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam08522	DUF1735	1.02e-08	36	157	7	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88787.1	2.89e-237	1	448	1	447
BCA52367.1	1.90e-185	1	447	1	446
QUT73146.1	1.90e-185	1	447	1	446
QUT40999.1	1.55e-184	1	447	1	446
QGT72760.1	2.06e-173	7	448	10	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GGL_A	1.39e-25	302	430	12	140	X-RayStructure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. [Bacteroides thetaiotaomicron],6OE2_A X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. Re-refinement of 3GGL with correct metal Mn replacing Zn. New metal confirmed with PIXE analysis of original sample. [Bacteroides thetaiotaomicron]
2KD7_A	1.47e-25	301	430	1	130	ChainA, Putative chitobiase [Bacteroides thetaiotaomicron VPI-5482]
3F2Z_A	6.55e-23	302	435	2	135	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000043	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_03552.