CAZyme Information: MGYG000002274_00881

Basic Information

• Species: Faecalibacterium prausnitzii_I
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_I
• CAZyme ID: MGYG000002274_00881
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729	MGYG000002274_5|CGC1	82727.92	8.8032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002274	2745360	Isolate	China	Asia

• Gene Location: Start: 92152; End: 94341 Strand: -

Full Sequence      

MKPTEEKIHSSPSDLPVYLFKQGNNCEAYRYFGAHIEQRAGETGVVFRVWAPHAVAISVV
GDFNSWKPGSHPMRKVDGDSVWELFIPGMKEYDVYKYCVTTRAGDLVYKADPYAFHAETR
PSNGSKVYDLNGYAWHDESWQAAQKKADVINGPMNIYEMHAGSWKTKEGNVPYNYSELAD
QLIPYITEMGYTHVELLPVMEYPFDGSWGYQVTGYFAPTSRYGTPKDLMAFVDKLHQAGI
GVIMDWVPAHFPKDQFGLYRFDGEPCYEDPNPKRGEHKEWGTMVFDFGRNEVQSFLISSA
LYWLEQYHIDGLRVDAVASMLYLDYNRKQGEWEPNKDGGKENLEAVAFLRKLNSTVLGRH
PHKYMIAEESTAWPLVTKPVSDGGLGFNFKWNMGWMNDMLSYMKTDPLFRAGNHNKVTFS
FFYAFSENFVLPISHDEVVHGKGSLINKMPGDYEAKFANLRTFFGYMLAHPGKKLLFMGQ
EFGQFTEWNETKPLDWMLLDYDKHTELQNYVKTLNKFYKNTPAFWQIDYSWEGFQWIVPD
DSQQSVVAFLRKDAAGKQVLVVCNFNPVLREGYTLGAPVSGTYKEILNSDDAEFGGSGAV
HNKAVRTKKKPLHGFEQSITITLPPMSTLYFEVPAKRSPRKKAEDKAAEKAEKATAKKTT
RTTKAKAEKPAEEKPKKTVKKTAKAEAAAEQKTPAKRGRKSKAETAAEAEPAAKPARKPR
AKKAAAPKE

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	184	484	5.5e-162	0.9966777408637874
CBM48	32	117	4e-20	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	13	636	101	726	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	32	632	27	620	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	4	631	593	1220	glycogen branching enzyme; Provisional
PRK12313	PRK12313	0.0	6	632	1	626	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	9	633	3	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK98932.1	0.0	1	645	1	644
AXA81819.1	0.0	1	645	1	644
CBL01646.1	0.0	1	645	1	644
AXB29737.1	0.0	1	645	1	644
ATL90043.1	0.0	1	645	1	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQZ_A	3.06e-226	10	639	125	779	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	4.33e-226	10	639	125	779	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	4.33e-226	10	639	125	779	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	8.67e-226	10	639	125	779	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	1.74e-225	10	639	125	779	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	1.17e-256	12	632	6	626	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q1AZ86	1.18e-249	13	630	100	716	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q5NXV7	2.53e-247	9	630	7	624	1,4-alpha-glucan branching enzyme GlgB OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=glgB PE=3 SV=1
Q2RR72	8.60e-244	14	629	112	728	1,4-alpha-glucan branching enzyme GlgB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=glgB PE=3 SV=1
O66936	1.77e-243	7	632	2	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002274_00881.