CAZyme Information: MGYG000002275_00329

Basic Information

• Species: Paraprevotella sp003477995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp003477995
• CAZyme ID: MGYG000002275_00329
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000002275_2|CGC2	43382.05	7.1953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002275	3751567	Isolate	China	Asia

• Gene Location: Start: 156507; End: 157649 Strand: +

Full Sequence      

MKYYLIAGEASGDLHAGKLMEALKQHDAAAAFRYFGGDEMQRQGGTLVRHYKDTAYMGFI
PVLLHLRQIFRNMDLCKQDIVQWQPDVVILVDYPGFNLSIAEFLRKNTQIPVYYYIAPKI
WAWKEHRIKNIRRDVDELFSILPFEIEFFEQKHHYPIHYVGNPSLDEVHEFLAQHPSDPE
GFRREHGLDNRPIIALLAGSRKQEIKDNLPMMAQIAREHAADYQIVLAGAPNIELSYYHQ
FIDKEQVHILSGCTYRILQHSAAALVTSGTATLETALFRVPQVVCYYTACGKAVSVLRKL
FLKVPFVSLVNLITAEEVVPELVADQMNPERLRRELQAILPGGAGREAQLQGYQRMLSRL
GEPGAPDRAAEQMVQLLQKK

Enzyme Prediction     

No EC number prediction in MGYG000002275_00329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	2.4e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.25e-100	1	380	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.08e-96	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.28e-74	4	375	2	372	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.28e-60	5	376	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.82e-45	1	332	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT93317.1	4.21e-178	1	377	1	376
ALJ61154.1	8.47e-178	1	377	1	376
QDO69124.1	9.70e-178	1	379	1	378
QUT45721.1	9.49e-172	1	379	1	378
QRQ48683.1	1.35e-171	1	379	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.68e-38	5	378	11	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	7.11e-38	5	378	11	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	9.77e-67	5	377	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.99e-62	5	379	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q6ALW0	1.40e-59	5	371	14	380	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B8JE78	1.09e-57	5	374	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
Q2IL69	1.09e-57	5	374	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002275_00329.