CAZyme Information: MGYG000002275_01959

Basic Information

• Species: Paraprevotella sp003477995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp003477995
• CAZyme ID: MGYG000002275_01959
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	MGYG000002275_19|CGC2	34736.89	9.917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002275	3751567	Isolate	China	Asia

• Gene Location: Start: 53635; End: 54531 Strand: -

Full Sequence      

MTTQKESKTTLRVRKASSSANASKTKVRRKPRRKRSGGKRLLPFLKVPAWKVWLGAVLVA
VAYILFFYYFFVDPFSFRWKALYGDEGYPSGYDVHGIDISRYQGNIDWEMLRNASIQSSP
VRFVFIKGTEGVSIVDENFNLNFYQAKKNDFIRGVYHFYTPDVDATRQAQFFMKQVHLEP
GDLPPVLDVEKAGDLSKEDLQREVKKWLSLVEERYKVKPIIYSGYKFKMKYLSDSLLNTY
PFWIAHYYVDKLSYKGPWHFWQYTDSGKLKGIKGNVDCNLFHGSLKELEAMTIPDESD

Enzyme Prediction     

No EC number prediction in MGYG000002275_01959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	97	272	5e-51	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	5.29e-80	95	283	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	5.63e-62	92	283	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	1.70e-55	95	281	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	5.05e-53	97	272	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	9.47e-50	92	290	61	262	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI93433.1	2.37e-106	47	295	17	266
QYR10351.1	2.68e-106	46	293	29	277
QUB48086.1	9.25e-106	41	296	32	290
QUB94355.1	9.56e-106	47	295	17	266
QUB91634.1	1.36e-105	47	295	17	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	1.98e-32	92	289	14	214	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	6.83e-26	94	291	5	212	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	1.31e-21	93	281	19	207	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	8.97e-21	93	281	19	207	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
6ZM8_A	1.84e-11	94	291	2	204	ChainA, muramidase [Sodiomyces alcalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	2.69e-55	89	289	62	262	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P76421	5.36e-55	89	290	62	263	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	4.24e-54	89	290	62	263	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	1.82e-24	94	291	82	289	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	1.79e-21	93	289	8	204	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999940	0.000080	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
50	72