CAZyme Information: MGYG000002275_02640

Basic Information

• Species: Paraprevotella sp003477995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp003477995
• CAZyme ID: MGYG000002275_02640
• CAZy Family: GH35
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
948	MGYG000002275_33|CGC1	107498.44	6.2804

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002275	3751567	Isolate	China	Asia

• Gene Location: Start: 26433; End: 29279 Strand: +

Full Sequence      

MIKKHFLWLLMSFCFLATSAWALPEKHFKHPDRIKYDQNCFQIEGRDVFVFSAAFHYFRV
PQELWRDRFRKIKEAGFNTVETYVPWNWHERNMPKNVRDFSQCDFSDLKEWLRMAHEEFD
LYTIVRPGPFICAEWAGGAYPRWLAKYCPEKYETSFWLRSNHPEHLKWARHWYDAVCPVF
AQEQITRKKPGEKGIIMVQLENEYIYFGMESEKKKEVLAFLSKACTDNGIDVPLFTCVTP
EVRGASDEVISQLFDMDNQYVWWNVHEAKSRIENLKKEQPNAPAFVCELQGGWFSTVGGG
LSEDSYLDGRHARGMALMAMAGGATGLNYYMFFGGTHFAGWGARRMTTTYDYGAALKENG
GVGEKYFAVKAVGRFVAKYGTALAQSAPVAFTANVPEERLTVGVRQAKDGTLFFFFFNRD
KKERFNNLVQIQTKDGKLYPIACVLDALDSKVLVLPSGASQGFWYPENVTGPARSSVHGA
VMSGAAFTGEQNPADRPALLPLPIRISSAEYCVEPFCGDWQKLKRGVSLPELDVNDCRYS
MYRSRVKLSEKDVQKYGSLIFEMYTGDPMYVQVNGKVVPRASEDELDNTFLLKDVLHAGE
NEIIAVYENRGHAHGYRPMEELSGMKAGGLGAGMSEVIPVEEWMVKKMDSSSDTDIPEFL
SNKEGWDKIMLDAGTIADLATLQIAGLKQPKWPAAWVLQQQNGTAVYRTTLHFTDKMLRE
GTTVLEFACVDDGGALWVNGKKVAEHQEWDKPFITDLADYLHAGDNEVAIVVSNNSGAGG
LLKAVRLYRAMTILKTLNWEVSTDLGGVCAGFTEGRSGEYTWKPCALKTDGVVPRKGSYA
PAGERDGLLKWYRVKFNLPKKEKGIWVPWRALVNASGSGYMWLNGHNIGRYWEEGPQREF
FLPECWLKFGEENVLILGLRESEQKGALLESLEILPYYEDAEYRADYE

Enzyme Prediction     

No EC number prediction in MGYG000002275_02640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	41	372	1.3e-93	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	8.39e-72	41	374	2	316	Glycosyl hydrolases family 35.
PLN03059	PLN03059	6.49e-28	34	360	30	325	beta-galactosidase; Provisional
COG1874	GanA	1.32e-22	34	204	1	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	1.92e-08	666	776	24	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02449	Glyco_hydro_42	2.51e-06	58	204	5	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP57068.1	0.0	10	943	7	921
ASM65763.1	0.0	10	943	7	921
QQT77688.1	0.0	10	943	7	921
QUU07680.1	0.0	10	948	7	928
BAD47373.1	0.0	17	942	25	928

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	9.04e-38	33	372	17	335	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3THC_A	1.16e-37	34	370	11	328	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	1.42e-37	34	370	35	352	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	2.53e-37	34	370	35	352	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
7KDV_A	5.34e-36	33	372	17	337	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5R7P4	1.03e-37	34	370	34	351	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q60HF6	3.39e-37	34	372	34	353	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q58D55	4.71e-37	33	370	32	350	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
P16278	7.72e-37	34	370	34	351	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
O19015	1.29e-36	33	372	34	354	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000411	0.998845	0.000204	0.000189	0.000160	0.000159

TMHMM  Annotations     

start	end
5	24