CAZyme Information: MGYG000002276_01469

Basic Information

• Species: OF09-33XD sp003481995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; OF09-33XD; OF09-33XD sp003481995
• CAZyme ID: MGYG000002276_01469
• CAZy Family: GT35
• CAZyme Description: Maltodextrin phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
175		19923.75	4.7666

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002276	4093426	Isolate	China	Asia

• Gene Location: Start: 84262; End: 84789 Strand: +

Full Sequence      

MLNPIFKKEKFKKSVREEVKNLFRTTLEEANSHQIYQAVCYVVKDVIIDNWMKTQKVMNE
TDPKIVYYMSMEFLTGRYLGNNLLNLTAYGEVKEALDELGIDLNAIEDEERDPALGNGGL
GRLAACFLDSLATLGYAAYGCGIRYHYGMFKQEIRDGYQVEVPDNWLKDGAIPSS

Enzyme Prediction     

EC	2.4.1.1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04300	GT35_Glycogen_Phosphorylase	6.92e-86	12	170	1	159	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0058	GlgP	7.55e-60	7	170	5	167	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14986	PRK14986	2.04e-53	30	170	36	176	glycogen phosphorylase; Provisional
pfam00343	Phosphorylase	4.11e-53	96	170	1	75	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
PRK14985	PRK14985	1.98e-49	4	169	3	164	maltodextrin phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM07938.1	1.14e-115	1	173	1	173
QRO36982.1	7.59e-86	1	170	1	170
QYX27044.1	7.59e-86	1	170	1	170
QBF73678.1	7.59e-86	1	170	1	170
QCU02129.1	1.06e-85	1	170	1	170

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CEH_A	1.47e-43	30	170	24	164	Humanliver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FC0_A	1.60e-43	30	170	46	186	HUMANLIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1XOI_A	1.60e-43	30	170	46	186	HumanLiver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]
3DD1_A	1.60e-43	30	170	48	188	Crystalstructure of glycogen phophorylase complexed with an anthranilimide based inhibitor GSK254 [Homo sapiens],3DD1_B Crystal structure of glycogen phophorylase complexed with an anthranilimide based inhibitor GSK254 [Homo sapiens],3DDS_A Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK261 [Homo sapiens],3DDS_B Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK261 [Homo sapiens],3DDW_A Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK055 [Homo sapiens],3DDW_B Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK055 [Homo sapiens]
2QLL_A	1.60e-43	30	170	47	187	Humanliver glycogen phosphorylase- GL complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q00766	8.93e-46	13	170	46	203	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
Q9PKE6	9.00e-44	9	170	11	172	Glycogen phosphorylase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=glgP PE=3 SV=1
Q9XTL9	1.33e-43	36	170	53	187	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
P06737	8.76e-43	30	170	47	187	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4
Q5MIB5	8.82e-43	30	170	47	187	Glycogen phosphorylase, liver form OS=Ovis aries OX=9940 GN=PYGL PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002276_01469.