CAZyme Information: MGYG000002277_03532

Basic Information

• Species: Marvinbryantia sp900066075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp900066075
• CAZyme ID: MGYG000002277_03532
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		30191.12	4.6184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002277	3435610	Isolate	China	Asia

• Gene Location: Start: 74; End: 856 Strand: +

Full Sequence      

MQERLDSIVFQTYPVSKIIVLDDCSSDNSIDVIEKYIANNKTNIPIELYKNEKNSGSVFA
QWQKAFNMADGEYVWIAEADDSCNEKFLETVMRGFDDPEVVISYCESLTMDENNKILMGD
LRVWIDIFKTHKWDADYVKDGKEEVAETMCINNTIANVSSAVFRKGDYNQIIEGAKSYKL
AGDWYVYMNILKLGKIAYFKESLNYHRMQSQGLTLSTSHEKEFEEIVRLQDFALENFDVS
DAVKAKVYERREREKKRFGL

Enzyme Prediction     

No EC number prediction in MGYG000002277_03532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	2	106	5.9e-18	0.5941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	3.29e-18	3	208	15	204	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	8.37e-16	5	110	16	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.71e-15	2	105	14	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	3.13e-09	5	101	74	168	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG0463	WcaA	7.19e-09	5	203	22	214	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ49630.1	2.49e-115	3	260	80	337
AAS39241.1	1.20e-62	3	248	164	411
ANA83353.1	4.00e-62	1	247	386	631
AFQ09207.1	2.10e-61	3	248	384	631
QHH90956.1	2.10e-61	3	248	384	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	4.48e-07	5	214	24	223	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32268	1.08e-06	2	193	22	231	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002277_03532.