CAZyme Information: MGYG000002278_01718

Basic Information

• Species: Eubacterium_I ramulus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_I; Eubacterium_I ramulus_A
• CAZyme ID: MGYG000002278_01718
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000002278_7|CGC1	40227.22	6.8341

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002278	3656069	Isolate	China	Asia

• Gene Location: Start: 76077; End: 77132 Strand: +

Full Sequence      

MKKYQIVEISENYNHAGTKATQDIAEVADVLKYERILIRMNTTKRTKLAKVQRQIGYRKD
WAECLKRVEENSVILLQHPFHYPQLTREKTLTELKEKKHVKFISLIHDVEELRAFRYNDY
YKGEFEFMLRIADVLIVHNAVMKQFFIERGVSEEKIVTLEIFDYLQKGSVINIPKFEKAI
TVAGNLDTEKCGYVGQLGELSGVSVKLYGMNYDKKMDQCENVQYFGSFPSDEIPGKLTSG
FGLVWDGASIDGCVGQSGQYLRYNNPHKLSLYLSSGLPVIIWKEAAEADFVEKQGVGICV
DSLKELSAKFEMLDENAYNKYAESVRELSEKLRTGQFGKYAILSAEDILKL

Enzyme Prediction     

No EC number prediction in MGYG000002278_01718.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	10	345	2.1e-103	0.9813664596273292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.04e-101	1	349	1	333	sugar transferase.
cd03794	GT4_WbuB-like	4.12e-10	4	331	32	379	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE73678.1	1.25e-146	1	350	1	350
CUU52885.1	6.32e-123	1	349	1	349
BAP87070.1	6.32e-123	1	349	1	349
BBO93532.1	6.32e-123	1	349	1	349
BAP87085.1	6.32e-123	1	349	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	1.18e-11	68	345	64	325	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	2.89e-42	101	350	90	328	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
B3XPQ7	6.89e-24	68	345	62	328	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	6.48e-22	48	345	29	333	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
A0A0H2UR93	5.61e-21	73	345	67	329	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	6.40e-11	68	345	62	323	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002278_01718.