CAZyme Information: MGYG000002279_01590

Basic Information

• Species: Dorea_A longicatena_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Dorea_A; Dorea_A longicatena_B
• CAZyme ID: MGYG000002279_01590
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000002279_7|CGC1	36902.71	7.411

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002279	3143549	Isolate	China	Asia

• Gene Location: Start: 5916; End: 6917 Strand: +

Full Sequence      

MKLRHFAVFGGIFTVIICLLLFLFIVTADDEENSTSYFDFSGLNLSEEVLKHQPTVEKYA
KEYGISDYVNYLLAIMQVESGGTATDVMQSSESMGLPPNSLSTEESIKQGCKYFSELLKS
AEAKGCDIDTVVQAYNYGGGFIDYVAKHGKKYTFELAVSFAKDKSGGVKVTYKNEISIKE
NGGWRYKYGNMFYVRLVNQYLAVPSFSDATAQAIFKEALKYQGWKYVFGGSNPNTSFDCS
GLTSWCYGKAGISLPRTAQAQYDATQHIPLSQAKAGDLVFFHSTYNSGTYVTHVGIYAGN
NRMYHAGDPIGYADLTSPYWQKHLIGAGRVKSK

Enzyme Prediction     

No EC number prediction in MGYG000002279_01590.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	1.38e-81	46	201	1	165	Lysozyme-like.
cd16891	CwlT-like	1.75e-77	52	202	1	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	2.19e-37	223	329	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	9.37e-36	207	330	362	481	invasion associated endopeptidase.
COG0791	Spr	1.11e-26	202	327	63	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL22199.1	1.42e-246	1	333	1	333
QIB54707.1	3.61e-222	1	333	1	334
QMW79222.1	3.61e-222	1	333	1	334
CBL37506.1	2.43e-220	1	332	1	333
ALU16411.1	4.02e-219	1	332	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	3.26e-167	30	331	5	307	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	1.72e-149	27	330	4	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	8.88e-16	211	330	14	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
4XCM_A	1.16e-13	214	330	117	230	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
6BIQ_A	4.42e-13	223	319	167	267	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	1.22e-77	39	331	47	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	5.66e-25	214	330	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01839	7.17e-25	214	330	412	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
O34636	1.23e-24	47	199	50	202	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
Q01836	1.28e-24	213	330	354	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994347	0.004883	0.000625	0.000019	0.000012	0.000153

TMHMM  Annotations     

start	end
5	27