CAZyme Information: MGYG000002281_00329

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_00329
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002281_1|CGC8	43789.79	6.925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 473752; End: 474891 Strand: -

Full Sequence      

MKKLLLSFITATLLSSIPCSSVIAQELPAQKETLATIVKVNDYFMKKYADYTLPSFFGRV
RPSNIWTRGVYYEGLMALYSIYPREDYYSYTYDWANFHKWGMRNGNTTRNADDQCCGQVY
IDLYNMCPSDPNMIRNIKASIDMVVNTPQVNDWWWIDAIQMAMPIYAKFGKMTGDQKYYN
KMWDLYTYTRNTHGEAGMYNAKEGLWWRDQDFDPPYKEPNGKNCYWSRGNGWVYAALVRV
LDEIPADETHRQDYINDFLTMSKALKQCQRTDGFWNVSLHDESNFGGKETSGTALFVYGM
AWGIRNGLLDRKEYLPIVLKAWNAMVKEAVHPNGFLGYVQGTGKEPKDGQPVTYKSVPDF
EDYGVGCFLLAGTEVYKLK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	61	377	1.8e-93	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.67e-121	36	379	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.22e-49	45	378	8	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT69872.1	9.55e-291	1	379	1	379
QMW86517.1	8.80e-287	1	379	1	379
ALJ43461.1	8.80e-287	1	379	1	379
QQA07689.1	8.80e-287	1	379	1	379
QUT42070.1	1.25e-286	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	3.20e-74	1	374	1	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.08e-65	31	374	14	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	7.61e-48	60	379	48	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	5.09e-14	62	378	35	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.10e-13	62	378	25	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	2.77e-51	66	379	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	4.90e-47	60	379	55	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	1.70e-33	153	375	199	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.79e-13	62	378	35	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000385	0.550602	0.448352	0.000250	0.000209	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_00329.